Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMetabotropic glutamate receptor 6 (mGlu6)
LigandBDBM50207811
Substrate/Competitorn/a
Meas. Tech.ChEMBL_443089
EC50 51000±n/a nM
Citation Marinozzi, MSerpi, MAmori, LGavilan Diaz, MCostantino, GMeyer, UFlor, PJGasparini, FHeckendorn, RKuhn, RGiorgi, GHermit, MBThomsen, CPellicciari, R Synthesis and preliminary pharmacological evaluation of the four stereoisomers of (2S)-2-(2'-phosphono-3'-phenylcyclopropyl)glycine, the first class of 3'-substituted trans C1'-2'-2-(2'-phosphonocyclopropyl)glycines. Bioorg Med Chem15:3161-70 (2007) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Metabotropic glutamate receptor 6 (mGlu6)
Name:Metabotropic glutamate receptor 6 (mGlu6)
Synonyms:GRM6 | mGlu6 | mGluR6 | metabotropic glutamate 6
Type:Enzyme
Mol. Mass.:95095.82
Organism:Rattus norvegicus (Rat)
Description:P35349
Residue:871
Sequence:
MGRLPVLLLWLAWWLSQAGIACGAGSVRLAGGLTLGGLFPVHARGAAGRACGALKKEQGV
HRLEAMLYALDRVNADPELLPGVRLGARLLDTCSRDTYALEQALSFVQALIRGRGDGDEA
SVRCPGGVPPLRSAPPERVVAVVGASASSVSIMVANVLRLFAIPQISYASTAPELSDSTR
YDFFSRVVPPDSYQAQAMVDIVRALGWNYVSTLASEGNYGESGVEAFVQISREAGGVCIA
QSIKIPREPKPGEFHKVIRRLMETPNARGIIIFANEDDIRRVLEATRQANLTGHFLWVGS
DSWGSKISPILNLEEEAVGAITILPKRASIDGFDQYFMTRSLENNRRNIWFAEFWEENFN
CKLTSSGGQSDDSTRKCTGEERIGQDSAYEQEGKVQFVIDAVYAIAHALHSMHQALCPGH
TGLCPAMEPTDGRTLLHYIRAVRFNGSAGTPVMFNENGDAPGRYDIFQYQATNGSASSGG
YQAVGQWAEALRLDMEVLRWSGDPHEVPPSQCSLPCGPGERKKMVKGVPCCWHCEACDGY
RFQVDEFTCEACPGDMRPTPNHTGCRPTPVVRLTWSSPWAALPLLLAVLGIMATTTIMAT
FMRHNDTPIVRASGRELSYVLLTGIFLIYAITFLMVAEPCAAICAARRLLLGLGTTLSYS
ALLTKTNRIYRIFEQGKRSVTPPPFISPTSQLVITFGLTSLQVVGVIAWLGAQPPHSVID
YEEQRTVDPEQARGVLKCDMSDLSLIGCLGYSLLLMVTCTVYAIKARGVPETFNEAKPIG
FTMYTTCIIWLAFVPIFFGTAQSAEKIYIQTTTLTVSLSLSASVSLGMLYVPKTYVILFH
PEQNVQKRKRSLKKTSTMAAPPQNENAEDAK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50207811
NameBDBM50207811
Synonyms:(2S,1'R,2'S,3'R)-2-(2'-phosphono-3'-phenylcyclopropyl)glycine | CHEMBL392420
TypeSmall organic molecule
Emp. Form.C11H14NO5P
Mol. Mass.271.2063
SMILESNC([C@H]1[C@@H]([C@@H]1P(O)(O)=O)c1ccccc1)C(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a