Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDehydrogenase/reductase SDR family member 9
LigandBDBM50371163
Substrate/Competitorn/a
Meas. Tech.ChEMBL_447932
IC50>250000±n/a nM
Citation Harrak, YRosell, GDaidone, GPlescia, SSchillaci, DPujol, MD Synthesis and biological activity of new anti-inflammatory compounds containing the 1,4-benzodioxine and/or pyrrole system. Bioorg Med Chem15:4876-90 (2007) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Dehydrogenase/reductase SDR family member 9
Name:Dehydrogenase/reductase SDR family member 9
Synonyms:3-alpha hydroxysteroid dehydrogenase | 3-alpha-HSD | Short-chain dehydrogenase/reductase retSDR8
Type:PROTEIN
Mol. Mass.:35223.09
Organism:Rattus norvegicus
Description:ChEMBL_447932
Residue:319
Sequence:
MLLWVLALLFLCAFLWNYKGQLKIADIADKYIFITGCDSGFGNLAARTFDRKGFRVIAAC
LTESGSEALKAKTSERLHTVLLDVTNPENVKETAQWVKSHVGEKGLWGLINNAGVLGVLA
PTDWLTVDDYREPIEVNLFGLINVTLNMLPLVKKARGRVINVSSIGGRLAFGGGGYTPSK
YAVEGFNDSLRRDMKAFGVHVSCIEPGLFKTGLADPIKTTEKKLAIWKHLSPDIKQQYGE
GYIEKSLHRLKSSTSSVNLDLSLVVECMDHALTSLFPKTRYTAGKDAKTFWIPLSHMPAA
LQDFLLLKEKVELANPQAV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50371163
NameBDBM50371163
Synonyms:CHEMBL236239
TypeSmall organic molecule
Emp. Form.C12H8FNO3
Mol. Mass.233.1952
SMILESOC(=O)C(=O)c1cccn1-c1ccccc1F
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a