Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLow molecular weight phosphotyrosine protein phosphatase (LMWPTP)
LigandBDBM50214527
Substrate/Competitorn/a
Meas. Tech.ChEMBL_448046
IC50 2500±n/a nM
Citation Maccari, RPaoli, POttanà, RJacomelli, MCiurleo, RManao, GSteindl, TLanger, TVigorita, MGCamici, G 5-Arylidene-2,4-thiazolidinediones as inhibitors of protein tyrosine phosphatases. Bioorg Med Chem15:5137-49 (2007) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Low molecular weight phosphotyrosine protein phosphatase (LMWPTP)
Name:Low molecular weight phosphotyrosine protein phosphatase (LMWPTP)
Synonyms:ACP1 | Adipocyte acid phosphatase | LMW-PTP | LMW-PTPase | LMWPTP | Low molecular weight cytosolic acid phosphatase | Low molecular weight phosphotyrosine protein phosphatase | Red cell acid phosphatase 1 | low molecular weight phosphotyrosine protein phosphatase isoform c
Type:n/a
Mol. Mass.:18042.81
Organism:Homo sapiens (Human)
Description:P24666
Residue:158
Sequence:
MAEQATKSVLFVCLGNICRSPIAEAVFRKLVTDQNISENWRVDSAATSGYEIGNPPDYRG
QSCMKRHGIPMSHVARQITKEDFATFDYILCMDESNLRDLNRKSNQVKTCKAKIELLGSY
DPQKQLIIEDPYYGNDSDFETVYQQCVRCCRAFLEKAH
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50214527
NameBDBM50214527
Synonyms:4-((5-(4-(benzyloxy)benzylidene)-2,4-dioxothiazolidin-3-yl)methyl)benzoic acid | 4-[5-(4-benzyloxybenzylidene)-2,4-dioxothiazolidin-3-yl]methylbenzoic acid | CHEMBL235595
TypeSmall organic molecule
Emp. Form.C25H19NO5S
Mol. Mass.445.487
SMILESOC(=O)c1ccc(CN2C(=O)S\C(=C/c3ccc(OCc4ccccc4)cc3)C2=O)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a