Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetProtein kinase Pfmrk
LigandBDBM50111446
Substrate/Competitorn/a
Meas. Tech.ChEMBL_456708
IC50>500000±n/a nM
Citation Woodard, CLKeenan, SMGerena, LWelsh, WJGeyer, JAWaters, NC Evaluation of broad spectrum protein kinase inhibitors to probe the architecture of the malarial cyclin dependent protein kinase Pfmrk. Bioorg Med Chem Lett17:4961-6 (2007) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Protein kinase Pfmrk
Name:Protein kinase Pfmrk
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:37992.30
Organism:Plasmodium falciparum
Description:ChEMBL_640752
Residue:324
Sequence:
MENNSTERYIFKPNFLGEGSYGKVYKAYDTILKKEVAIKKMKLNEISNYIDDCGINFVLL
REIKIMKEIKHKNIMSALDLYCEKDYINLVMEIMDYDLSKIINRKIFLTDSQKKCILLQI
LNGLNVLHKYYFMHRDLSPANIFINKKGEVKLADFGLCTKYGYDMYSDKLFRDKYKKNLN
LTSKVVTLWYRAPELLLGSNKYNSSIDMWSFGCIFAELLLQKALFPGENEIDQLGKIFFL
LGTPNENNWPEALCLPLYTEFTKATKKDFKTYFKIDDDDCIDLLTSFLKLNAHERISAED
AMKHRYFFNDPLPCDISQLPFNDL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50111446
NameBDBM50111446
Synonyms:5-Chloro-naphthalene-1-sulfonic acid (6-amino-hexyl)-amide | CHEMBL41631 | N-(6-AMINOHEXYL)-5-CHLORO-1-NAPHTHALENESULFONAMIDE | N-(6-aminohexyl)-5-chloronaphthalene-1-sulfonamide
TypeSmall organic molecule
Emp. Form.C16H21ClN2O2S
Mol. Mass.340.868
SMILESNCCCCCCNS(=O)(=O)c1cccc2c(Cl)cccc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a