Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetFatty-acid amide hydrolase 1
LigandBDBM50371973
Substrate/Competitorn/a
Meas. Tech.ChEMBL_464389
IC50>40000±n/a nM
Citation Wheelock, CENishi, KYing, AJones, PDColvin, MEOlmstead, MMHammock, BD Influence of sulfur oxidation state and steric bulk upon trifluoromethyl ketone (TFK) binding kinetics to carboxylesterases and fatty acid amide hydrolase (FAAH). Bioorg Med Chem16:2114-30 (2008) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Fatty-acid amide hydrolase 1
Name:Fatty-acid amide hydrolase 1
Synonyms:Anandamide amidohydrolase | Anandamide amidohydrolase 1 | FAAH | FAAH1 | Fatty Acid Amide Hydrolase (FAAH) | Fatty-acid amide hydrolase (FAAH) | Oleamide hydrolase 1
Type:Protein
Mol. Mass.:63071.19
Organism:Homo sapiens (Human)
Description:O00519
Residue:579
Sequence:
MVQYELWAALPGASGVALACCFVAAAVALRWSGRRTARGAVVRARQRQRAGLENMDRAAQ
RFRLQNPDLDSEALLALPLPQLVQKLHSRELAPEAVLFTYVGKAWEVNKGTNCVTSYLAD
CETQLSQAPRQGLLYGVPVSLKECFTYKGQDSTLGLSLNEGVPAECDSVVVHVLKLQGAV
PFVHTNVPQSMFSYDCSNPLFGQTVNPWKSSKSPGGSSGGEGALIGSGGSPLGLGTDIGG
SIRFPSSFCGICGLKPTGNRLSKSGLKGCVYGQEAVRLSVGPMARDVESLALCLRALLCE
DMFRLDPTVPPLPFREEVYTSSQPLRVGYYETDNYTMPSPAMRRAVLETKQSLEAAGHTL
VPFLPSNIPHALETLSTGGLFSDGGHTFLQNFKGDFVDPCLGDLVSILKLPQWLKGLLAF
LVKPLLPRLSAFLSNMKSRSAGKLWELQHEIEVYRKTVIAQWRALDLDVVLTPMLAPALD
LNAPGRATGAVSYTMLYNCLDFPAGVVPVTTVTAEDEAQMEHYRGYFGDIWDKMLQKGMK
KSVGLPVAVQCVALPWQEELCLRFMREVERLMTPEKQSS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50371973
NameBDBM50371973
Synonyms:CHEMBL402615
TypeSmall organic molecule
Emp. Form.C7H11F3OS
Mol. Mass.200.222
SMILESCCCCSCC(=O)C(F)(F)F
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a