Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetADP-ribosylation factor 1
LigandBDBM50373058
Substrate/Competitorn/a
Meas. Tech.ChEMBL_466424
Kd 620±n/a nM
Citation Zhang, QMajor, MBTakanashi, SCamp, NDNishiya, NPeters, ECGinsberg, MHJian, XRandazzo, PASchultz, PGMoon, RTDing, S Small-molecule synergist of the Wnt/beta-catenin signaling pathway. Proc Natl Acad Sci U S A104:7444-8 (2007) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
ADP-ribosylation factor 1
Name:ADP-ribosylation factor 1
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:20697.03
Organism:Homo sapiens (Human)
Description:ChEMBL_466424
Residue:181
Sequence:
MGNIFANLFKGLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAV
LLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLSNQLRNQ
K
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50373058
NameBDBM50373058
Synonyms:CHEMBL259181
TypeSmall organic molecule
Emp. Form.C36H33N5O2
Mol. Mass.567.6795
SMILESOC[C@H](Cc1ccccc1)Nc1nc(Oc2ccc3CCCc3c2)nc2n(Cc3ccc(cc3)-c3ccccc3)cnc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a