Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetInterleukin-2 (IL-2)
LigandBDBM50229786
Substrate/Competitorn/a
Meas. Tech.ChEMBL_466590
Ki 60±n/a nM
Citation Wells, JAMcClendon, CL Reaching for high-hanging fruit in drug discovery at protein-protein interfaces. Nature450:1001-1009 (2007) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Interleukin-2 (IL-2)
Name:Interleukin-2
Synonyms:IL-2 | INN=Aldesleukin | Interleukin-2 | T-cell growth factor | TCGF
Type:Enzyme
Mol. Mass.:17630.05
Organism:Homo sapiens (Human)
Description:P60568
Residue:153
Sequence:
MYRMQLLSCIALSLALVTNSAPTSSSTKKTQLQLEHLLLDLQMILNGINNYKNPKLTRML
TFKFYMPKKATELKHLQCLEEELKPLEEVLNLAQSKNFHLRPRDLISNINVIVLELKGSE
TTFMCEYADETATIVEFLNRWITFCQSIISTLT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50229786
NameBDBM50229786
Synonyms:5-[2,3-DICHLORO-4-(5-{1-[2-(2-GUANIDINO-4-METHYL-PENTANOYLAMINO)-ACETYL]-PIPERIDIN-4-YL}-1-METHYL-1H-PYRAZOL-3-YL)-PHENOXYMETHYL]-FURAN-2-CARBOXYLIC ACID | 5-[2,3-Dichloro-4-(5-{1-[2-((R)-2-guanidino-4-methyl-1-oxo-pentylamino)-acetyl]-piperidin-4-yl}-1-methyl-1H-pyrazol-3-yl)-phenoxymethyl]-furan-2-carboxylic acid | 5-[2,3-Dichloro-4-(5-{1-[2-((R)-2-guanidino-4-methyl-pentanoylamino)-acetyl]-piperidin-4-yl}-1-methyl-1H-pyrazol-3-yl)-phenoxymethyl]-furan-2-carboxylic acid | CHEMBL429852 | SP-4206
TypeSmall organic molecule
Emp. Form.C30H37Cl2N7O6
Mol. Mass.662.564
SMILES[#6]-[#6](-[#6])-[#6]-[#6](\[#7+]=[#6](\[#7])-[#7])-[#6](=O)-[#7]-[#6]-[#6](=O)-[#7]-1-[#6]-[#6]-[#6](-[#6]-[#6]-1)-c1cc(nn1-[#6])-c1ccc(-[#8]-[#6]-c2ccc(o2)-[#6](-[#8-])=O)c(Cl)c1Cl
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a