Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target6-phosphogluconate dehydrogenase (6PGD)
LigandBDBM50236531
Substrate/Competitorn/a
Meas. Tech.ChEMBL_467396
IC50 1450±n/a nM
Citation Shin, ESPark, JShin, JMCho, DCho, SYShin, DWHam, MKim, JBLee, TR Catechin gallates are NADP+-competitive inhibitors of glucose-6-phosphate dehydrogenase and other enzymes that employ NADP+ as a coenzyme. Bioorg Med Chem16:3580-6 (2008) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
6-phosphogluconate dehydrogenase (6PGD)
Name:6-phosphogluconate dehydrogenase (6PGD)
Synonyms:6-phosphogluconate dehydrogenase
Type:Protein
Mol. Mass.:53143.42
Organism:Homo sapiens (Human)
Description:P52209
Residue:483
Sequence:
MAQADIALIGLAVMGQNLILNMNDHGFVVCAFNRTVSKVDDFLANEAKGTKVVGAQSLKE
MVSKLKKPRRIILLVKAGQAVDDFIEKLVPLLDTGDIIIDGGNSEYRDTTRRCRDLKAKG
ILFVGSGVSGGEEGARYGPSLMPGGNKEAWPHIKTIFQGIAAKVGTGEPCCDWVGDEGAG
HFVKMVHNGIEYGDMQLICEAYHLMKDVLGMAQDEMAQAFEDWNKTELDSFLIEITANIL
KFQDTDGKHLLPKIRDSAGQKGTGKWTAISALEYGVPVTLIGEAVFARCLSSLKDERIQA
SKKLKGPQKFQFDGDKKSFLEDIRKALYASKIISYAQGFMLLRQAATEFGWTLNYGGIAL
MWRGGCIIRSVFLGKIKDAFDRNPELQNLLLDDFFKSAVENCQDSWRRAVSTGVQAGIPM
PCFTTALSFYDGYRHEMLPASLIQAQRDYFGAHTYELLAKPGQFIHTNWTGHGGTVSSSS
YNA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50236531
NameBDBM50236531
Synonyms:(-)-gallocatechin gallate | (2R,3S)-5,7-dihydroxy-2-(3,4,5-trihydroxyphenyl)-3,4-dihydro-2H-chromen-3-yl 3,4,5-trihydroxybenzoate | (2S,3R)-5,7-dihydroxy-2-(3,4,5-trihydroxyphenyl)-3,4-dihydro-2H-chromen-3-yl 3,4,5-trihydroxybenzoate | (2S,3R)-5,7-dihydroxy-2-(3,4,5-trihydroxyphenyl)chroman-3-yl 3,4,5-trihydroxybenzoate | CHEMBL264938 | Gallocatechin 3-O-gallate | gallocatechin gallate
TypeSmall organic molecule
Emp. Form.C22H18O11
Mol. Mass.458.3717
SMILESOc1cc(O)c2C[C@@H](OC(=O)c3cc(O)c(O)c(O)c3)[C@@H](Oc2c1)c1cc(O)c(O)c(O)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a