Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetGranzyme B
LigandBDBM50374286
Substrate/Competitorn/a
Meas. Tech.ChEMBL_469245
Ki 8±n/a nM
Citation Maryanoff, BECostanzo, MJ Inhibitors of proteases and amide hydrolases that employ an alpha-ketoheterocycle as a key enabling functionality. Bioorg Med Chem16:1562-95 (2008) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Granzyme B
Name:Granzyme B
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:27735.56
Organism:Homo sapiens
Description:ChEMBL_469245
Residue:247
Sequence:
MQPILLLLAFLLLPRADAGEIIGGHEAKPHSRPYMAYLMIWDQKSLKRCGGFLIRDDFVL
TAAHCWGSSINVTLGAHNIKEQEPTQQFIPVKRPIPHPAYNPKNFSNDIMLLQLERKAKR
TRAVQPLRLPSNKAQVKPGQTCSVAGWGQTAPLGKHSHTLQEVKMTVQEDRKCESDLRHY
YDSTIELCVGDPEIKKTSFKGDSGGPLVCNKVAQGIVSYGRNNGMPPRACTKVSSFVHWI
KKTMKRY
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50374286
NameBDBM50374286
Synonyms:CHEMBL428244
TypeSmall organic molecule
Emp. Form.C25H32N4O7
Mol. Mass.500.5442
SMILESCC[C@H](C)[C@H](NC(C)=O)C(=O)N[C@H]1CCc2cccc3C[C@H](N(c23)C1=O)C(=O)N[C@@H](CC(O)=O)C=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a