Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAcidic fibroblast growth factor
LigandBDBM50374509
Substrate/Competitorn/a
Meas. Tech.ChEMBL_469445
IC50 290000±n/a nM
Citation Liu, LBytheway, IKaroli, TFairweather, JKCochran, SLi, CFerro, V Design, synthesis, FGF-1 binding, and molecular modeling studies of conformationally flexible heparin mimetic disaccharides. Bioorg Med Chem Lett18:344-9 (2008) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Acidic fibroblast growth factor
Name:Acidic fibroblast growth factor
Synonyms:Acidic fibroblast growth factor | Beta-endothelial cell growth factor | ECGF-beta | Fibroblast growth factor 1 (FGF-1) | HBGF-1 | Heparin-binding growth factor 1 | aFGF
Type:Protein
Mol. Mass.:17461.01
Organism:Homo sapiens (Human)
Description:P05230
Residue:155
Sequence:
MAEGEITTFTALTEKFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQ
LSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEK
NWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50374509
NameBDBM50374509
Synonyms:CHEMBL403403
TypeSmall organic molecule
Emp. Form.C27H46N2O21
Mol. Mass.734.6549
SMILESCCCOC(=O)[C@H]1O[C@H](O)[C@@H](O)[C@H](O)[C@H]1O[C@@H]1O[C@@H](CO)[C@H](O[C@H]2O[C@@H]([C@H](O[C@@H]3O[C@@H](CO)[C@H](O)[C@@H](O)[C@@H]3N)[C@@H](O)[C@@H]2O)C(O)=O)[C@@H](O)[C@@H]1N
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a