Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAldo-keto reductase family 1 member C21
LigandBDBM16452
Substrate/Competitorn/a
Meas. Tech.ChEMBL_470435
IC50 158000±n/a nM
Citation Dhagat, UEndo, SHara, AEl-Kabbani, O Inhibition of 3(17)alpha-hydroxysteroid dehydrogenase (AKR1C21) by aldose reductase inhibitors. Bioorg Med Chem16:3245-54 (2008) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Aldo-keto reductase family 1 member C21
Name:Aldo-keto reductase family 1 member C21
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:36879.72
Organism:Mus musculus
Description:ChEMBL_470435
Residue:323
Sequence:
MNSKCHCVILNDGNFIPVLGFGTALPLECPKSKAKELTKIAIDAGFHHFDSASVYNTEDH
VGEAIRSKIADGTVRREDIFYTSKVWCTSLHPELVRASLERSLQKLQFDYVDLYLIHYPM
ALKPGEENFPVDEHGKLIFDRVDLCATWEAMEKCKDAGLTKSIGVSNFNYRQLEMILNKP
GLKYKPVCNQVECHPYLNQMKLLDFCKSKDIVLVAYGVLGTQRYGGWVDQNSPVLLDEPV
LGSMAKKYNRTPALIALRYQLQRGIVVLNTSLKEERIKENMQVFEFQLSSEDMKVLDGLN
RNMRYIPAAIFKGHPNWPFLDEY
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM16452
NameBDBM16452
Synonyms:(4-oxo-3-{[5-(trifluoromethyl)-1,3-benzothiazol-2-yl]methyl}-3,4-dihydrophthalazin-1-yl)acetic acid | 2-(4-oxo-3-{[5-(trifluoromethyl)-1,3-benzothiazol-2-yl]methyl}-3,4-dihydrophthalazin-1-yl)acetic acid | Alond | CHEMBL10372 | Xedia | Zopolrestat
TypeSmall organic molecule
Emp. Form.C19H12F3N3O3S
Mol. Mass.419.377
SMILESOC(=O)Cc1nn(Cc2nc3cc(ccc3s2)C(F)(F)F)c(=O)c2ccccc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a