Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCyclin-Dependent Kinase 5 (CDK5)
LigandBDBM7262
Substrate/Competitorn/a
Meas. Tech.ChEMBL_475163
IC50 40±n/a nM
Citation Stukenbrock, HMussmann, RGeese, MFerandin, YLozach, OLemcke, TKegel, SLomow, ABurk, UDohrmann, CMeijer, LAusten, MKunick, C 9-cyano-1-azapaullone (cazpaullone), a glycogen synthase kinase-3 (GSK-3) inhibitor activating pancreatic beta cell protection and replication. J Med Chem51:2196-207 (2008) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Cyclin-Dependent Kinase 5 (CDK5)
Name:Cyclin-Dependent Kinase 5 (CDK5)
Synonyms:CDK5/p35 | Cyclin-dependent kinase 5 regulatory subunit 1 | Cyclin-dependent kinase 5/CDK5 activator 1
Type:Protein Complex
Mol. Mass.:n/a
Description:n/a
Components:This complex has 2 components.
Component 1
Name:Cyclin-T1/Cyclin-dependent-like kinase 5
Synonyms:CDK5 | Cyclin-dependent kinase 5 (CDK5/ p25) | Cyclin-dependent kinase 5 (CDK5/p35) | Cyclin-dependent-like kinase 5 (CDK5)
Type:Enzyme Subunit
Mol. Mass.:33308.61
Organism:Homo sapiens (human)
Description:n/a
Residue:292
Sequence:
MQKYEKLEKIGEGTYGTVFKAKNRETHEIVALKRVRLDDDDEGVPSSALREICLLKELKH
KNIVRLHDVLHSDKKLTLVFEFCDQDLKKYFDSCNGDLDPEIVKSFLFQLLKGLGFCHSR
NVLHRDLKPQNLLINRNGELKLADFGLARAFGIPVRCYSAEVVTLWYRPPDVLFGAKLYS
TSIDMWSAGCIFAELANAGRPLFPGNDVDDQLKRIFRLLGTPTEEQWPSMTKLPDYKPYP
MYPATTSLVNVVPKLNATGRDLLQNLLKCNPVQRISAEEALQHPYFSDFCPP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
Component 2
Name:Cyclin-dependent kinase 5 regulatory subunit 1
Synonyms:Cyclin-Dependent Kinase 5 Activator 1, p35 | Cyclin-dependent kinase 5 (CDK5/p25) | TPKII regulatory subunit | p35
Type:Enzyme Subunit
Mol. Mass.:34077.43
Organism:Homo sapiens (human)
Description:n/a
Residue:307
Sequence:
MGTVLSLSPSYRKATLFEDGAATVGHYTAVQNSKNAKDKNLKRHSIISVLPWKRIVAVSA
KKKNSKKVQPNSSYQNNITHLNNENLKKSLSCANLSTFAQPPPAQPPAPPASQLSGSQTG
GSSSVKKAPHPAVTSAGTPKRVIVQASTSELLRCLGEFLCRRCYRLKHLSPTDPVLWLRS
VDRSLLLQGWQDQGFITPANVVFLYMLCRDVISSEVGSDHELQAVLLTCLYLSYSYMGNE
ISYPLKPFLVESCKEAFWDRCLSVINLMSSKMLQINADPHYFTQVFSDLKNESGQEDKKR
LLLGLDR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM7262
NameBDBM7262
Synonyms:14-nitro-8,18-diazatetracyclo[9.7.0.0^{2,7}.0^{12,17}]octadeca-1(11),2,4,6,12(17),13,15-heptaen-9-one | 9-Nitropaullone | CHEMBL50894 | NSC 705701 | Paullone Analog 1 | alsterpaullone
TypeSmall organic molecule
Emp. Form.C16H11N3O3
Mol. Mass.293.2768
SMILES[O-][N+](=O)c1ccc2[nH]c-3c(CC(=O)Nc4ccccc-34)c2c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a