Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCAAX prenyl protease 1 homolog
LigandBDBM558
Substrate/Competitorn/a
Meas. Tech.ChEMBL_476919
IC50 1200±n/a nM
Citation Coffinier, CHudon, SEFarber, EAChang, SYHrycyna, CAYoung, SGFong, LG HIV protease inhibitors block the zinc metalloproteinase ZMPSTE24 and lead to an accumulation of prelamin A in cells. Proc Natl Acad Sci USA104:13432-7 (2007) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
CAAX prenyl protease 1 homolog
Name:CAAX prenyl protease 1 homolog
Synonyms:FACE-1 | Farnesylated proteins-converting enzyme 1 | Prenyl protein-specific endoprotease 1 | Zinc metalloproteinase Ste24 homolog
Type:PROTEIN
Mol. Mass.:54735.85
Organism:Mus musculus
Description:ChEMBL_476919
Residue:475
Sequence:
MGMWASVDAMWDFPAEKRIFGAVLLFSWTVYLWETFLAQRQRRIYKTTTRVPAELEQIMD
SDTFEKSRLYQLDKSTFSFWSGLYSEVEGTFILLFGGIPYLWRLSGQFCSSAGFGPEYEI
IQSLVFLLLATLFSALTGLPWSLYNTFVIEEKHGFNHQTLEFFMKDAIKKFIVTQCILLP
VSALLLYIIKIGGDYFFIYAWLFTLVVSLVLVTIYADYIAPLFDKFTPLPEGKLKQEIEV
MAKSIDFPLTKVYVVEGSKRSSHSNAYFYGFFKNKRIVLFDTLLEEYSVPNKDNQEESGM
EARNEGEGDSEEVKAKVKNKKQGCKNEEVLAVLGHELGHWKLGHTVKNIIISQMNSFLCF
FLFAVLIGRRELFAAFGFYDSQPTLIGLLIIFQFIFSPYNEVLSFCLTVLSRRFEFQADA
FAKKLGKAKDLYSALIKLNKDNLGFPVSDWLFSTWHYSHPPLLERLQALKNAKQD
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM558
n/a
NameBDBM558
Synonyms:N-{3-[(1R)-1-[(6R)-4-hydroxy-2-oxo-6-(2-phenylethyl)-6-propyl-5,6-dihydro-2H-pyran-3-yl]propyl]phenyl}-5-(trifluoromethyl)pyridine-2-sulfonamide | PNU-140690 | Sulfonamide-Containing 5,6-Dihydro-4-hydroxy-2-pyrones | Tipranavir | U-140690
TypeSmall organic molecule
Emp. Form.n/a
Mol. Mass.n/a
SMILESn/a
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: