Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAdenosine receptor A3
LigandBDBM50377684
Substrate/Competitorn/a
Meas. Tech.ChEMBL_479907
Ki 0.980000±n/a nM
Citation Melman, AGao, ZGKumar, DWan, TCGizewski, EAuchampach, JAJacobson, KA Design of (N)-methanocarba adenosine 5'-uronamides as species-independent A3 receptor-selective agonists. Bioorg Med Chem Lett18:2813-9 (2008) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Adenosine receptor A3
Name:Adenosine receptor
Synonyms:A3 adenosine receptor (hA3) | Adenosine A3 receptor (A3AR)
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:36197.32
Organism:Homo sapiens (Human)
Description:P0DMS8
Residue:318
Sequence:
MPNNSTALSLANVTYITMEIFIGLCAIVGNVLVICVVKLNPSLQTTTFYFIVSLALADIA
VGVLVMPLAIVVSLGITIHFYSCLFMTCLLLIFTHASIMSLLAIAVDRYLRVKLTVRYKR
VTTHRRIWLALGLCWLVSFLVGLTPMFGWNMKLTSEYHRNVTFLSCQFVSVMRMDYMVYF
SFLTWIFIPLVVMCAIYLDIFYIIRNKLSLNLSNSKETGAFYGREFKTAKSLFLVLFLFA
LSWLPLSIINCIIYFNGEVPQLVLYMGILLSHANSMMNPIVYAYKIKKFKETYLLILKAC
VVCHPSDSLDTSIEKNSE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50377684
NameBDBM50377684
Synonyms:CHEMBL257405
TypeSmall organic molecule
Emp. Form.C25H29ClN6O3Si
Mol. Mass.525.075
SMILESCNC(=O)[C@@]12C[C@@H]1[C@H]([C@H](O)[C@@H]2O)n1cnc2c(NCc3cccc(Cl)c3)nc(nc12)C#C[Si](C)(C)C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a