Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetFibroblast growth factor receptor 3
LigandBDBM50242740
Substrate/Competitorn/a
Meas. Tech.ChEMBL_531129
IC50 13±n/a nM
Citation McDermott, USharma, SVDowell, LGreninger, PMontagut, CLamb, JArchibald, HRaudales, RTam, ALee, DRothenberg, SMSupko, JGSordella, RUlkus, LEIafrate, AJMaheswaran, SNjauw, CNTsao, HDrew, LHanke, JHMa, XJErlander, MGGray, NSHaber, DASettleman, J Identification of genotype-correlated sensitivity to selective kinase inhibitors by using high-throughput tumor cell line profiling. Proc Natl Acad Sci USA104:19936-41 (2007) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Fibroblast growth factor receptor 3
Name:Fibroblast growth factor receptor 3
Synonyms:CD_antigen: CD333 | FGFR-3 | FGFR3 | Fibroblast growth factor receptor 3 (FGFR3) | JTK4
Type:Protein
Mol. Mass.:87699.57
Organism:Homo sapiens (Human)
Description:P22607
Residue:806
Sequence:
MGAPACALALCVAVAIVAGASSESLGTEQRVVGRAAEVPGPEPGQQEQLVFGSGDAVELS
CPPPGGGPMGPTVWVKDGTGLVPSERVLVGPQRLQVLNASHEDSGAYSCRQRLTQRVLCH
FSVRVTDAPSSGDDEDGEDEAEDTGVDTGAPYWTRPERMDKKLLAVPAANTVRFRCPAAG
NPTPSISWLKNGREFRGEHRIGGIKLRHQQWSLVMESVVPSDRGNYTCVVENKFGSIRQT
YTLDVLERSPHRPILQAGLPANQTAVLGSDVEFHCKVYSDAQPHIQWLKHVEVNGSKVGP
DGTPYVTVLKTAGANTTDKELEVLSLHNVTFEDAGEYTCLAGNSIGFSHHSAWLVVLPAE
EELVEADEAGSVYAGILSYGVGFFLFILVVAAVTLCRLRSPPKKGLGSPTVHKISRFPLK
RQVSLESNASMSSNTPLVRIARLSSGEGPTLANVSELELPADPKWELSRARLTLGKPLGE
GCFGQVVMAEAIGIDKDRAAKPVTVAVKMLKDDATDKDLSDLVSEMEMMKMIGKHKNIIN
LLGACTQGGPLYVLVEYAAKGNLREFLRARRPPGLDYSFDTCKPPEEQLTFKDLVSCAYQ
VARGMEYLASQKCIHRDLAARNVLVTEDNVMKIADFGLARDVHNLDYYKKTTNGRLPVKW
MAPEALFDRVYTHQSDVWSFGVLLWEIFTLGGSPYPGIPVEELFKLLKEGHRMDKPANCT
HDLYMIMRECWHAAPSQRPTFKQLVEDLDRVLTVTSTDEYLDLSAPFEQYSPGGQDTPSS
SSSGDDSVFAHDLLPPAPPSSGGSRT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50242740
NameBDBM50242740
Synonyms:CHEMBL459850 | N-(3-(7-Amino-1-methyl-2-oxo-1,2-dihydropyrimido[4,5-d]pyrimidin-3(4H)-yl)-4-methylphenyl)-3-(trifluoromethyl)benzamide | Type II inhibitor, 14
TypeSmall organic molecule
Emp. Form.C22H19F3N6O2
Mol. Mass.456.4205
SMILESCN1C(=O)N(Cc2cnc(N)nc12)c1cc(NC(=O)c2cccc(c2)C(F)(F)F)ccc1C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a