Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetGalectin-1
LigandBDBM50272205
Substrate/Competitorn/a
Meas. Tech.ChEMBL_510247
IC50 5000000±n/a nM
Citation Giguère, DBonin, MACloutier, PPatnam, RSt-Pierre, CSato, SRoy, R Synthesis of stable and selective inhibitors of human galectins-1 and -3. Bioorg Med Chem16:7811-23 (2008) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Galectin-1
Name:Galectin-1
Synonyms:14 kDa lectin | Galaptin | HPL | Lactose-binding lectin 1 | Lectin galactoside-binding soluble 1 | Putative MAPK-activating protein PM12
Type:beta galactoside-binding protein
Mol. Mass.:14713.53
Organism:Homo sapiens (Human)
Description:n/a
Residue:135
Sequence:
MACGLVASNLNLKPGECLRVRGEVAPDAKSFVLNLGKDSNNLCLHFNPRFNAHGDANTIV
CNSKDGGAWGTEQREAVFPFQPGSVAEVCITFDQANLTVKLPDGYEFKFPNRLNLEAINY
MAADGDFKIKCVAFD
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50272205
NameBDBM50272205
Synonyms:(E)-Methyl 4-(beta-D-galactopyranosyl)-but-2-enoate | CHEMBL446968
TypeSmall organic molecule
Emp. Form.C11H18O7
Mol. Mass.262.2564
SMILESCOC(=O)\C=C\C[C@@H]1O[C@H](CO)[C@H](O)[C@H](O)[C@H]1O |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a