Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetGalectin-1
LigandBDBM50272384
Substrate/Competitorn/a
Meas. Tech.ChEMBL_510247
IC50 2500000±n/a nM
Citation Giguère, DBonin, MACloutier, PPatnam, RSt-Pierre, CSato, SRoy, R Synthesis of stable and selective inhibitors of human galectins-1 and -3. Bioorg Med Chem16:7811-23 (2008) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Galectin-1
Name:Galectin-1
Synonyms:14 kDa lectin | Galaptin | HPL | Lactose-binding lectin 1 | Lectin galactoside-binding soluble 1 | Putative MAPK-activating protein PM12
Type:beta galactoside-binding protein
Mol. Mass.:14713.53
Organism:Homo sapiens (Human)
Description:n/a
Residue:135
Sequence:
MACGLVASNLNLKPGECLRVRGEVAPDAKSFVLNLGKDSNNLCLHFNPRFNAHGDANTIV
CNSKDGGAWGTEQREAVFPFQPGSVAEVCITFDQANLTVKLPDGYEFKFPNRLNLEAINY
MAADGDFKIKCVAFD
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50272384
NameBDBM50272384
Synonyms:(2R,3S,4S,5R,6S)-2-(hydroxymethyl)-6-(3-(4-(3-((2R,3S,4R,5S,6S)-3,4,5-trihydroxy-6-(hydroxymethyl)-tetrahydro-2H-pyran-2-ylthio)prop-1-ynyl)phenyl)prop-2-ynylthio)-tetrahydro-2H-pyran-3,4,5-triol | CHEMBL500405
TypeSmall organic molecule
Emp. Form.C24H30O10S2
Mol. Mass.542.619
SMILESOC[C@H]1O[C@@H](SCC#Cc2ccc(cc2)C#CCS[C@H]2O[C@@H](CO)[C@@H](O)[C@@H](O)[C@@H]2O)[C@H](O)[C@@H](O)[C@H]1O |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a