Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCannabinoid receptor 2
LigandBDBM50272598
Substrate/Competitorn/a
Meas. Tech.ChEMBL_510487
Ki 1±n/a nM
Citation Cheng, YAlbrecht, BKBrown, JBuchanan, JLBuckner, WHDiMauro, EFEmkey, RFremeau, RTHarmange, JCHoffman, BJHuang, LHuang, MLee, JHLin, FFMartin, MWNguyen, HQPatel, VFTomlinson, SAWhite, RDXia, XHitchcock, SA Discovery and optimization of a novel series of N-arylamide oxadiazoles as potent, highly selective and orally bioavailable cannabinoid receptor 2 (CB2) agonists. J Med Chem51:5019-34 (2008) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Cannabinoid receptor 2
Name:Cannabinoid receptor 2
Synonyms:CANNABINOID CB2 | CB-2 | CB2 | CB2A | CB2B | CNR2 | CX5 | Cannabinoid CB2 receptor | Cannabinoid receptor 2 (CB2) | Cannabinoid receptor 2 (CB2R) | hCB2
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:39690.94
Organism:Homo sapiens (Human)
Description:P34972
Residue:360
Sequence:
MEECWVTEIANGSKDGLDSNPMKDYMILSGPQKTAVAVLCTLLGLLSALENVAVLYLILS
SHQLRRKPSYLFIGSLAGADFLASVVFACSFVNFHVFHGVDSKAVFLLKIGSVTMTFTAS
VGSLLLTAIDRYLCLRYPPSYKALLTRGRALVTLGIMWVLSALVSYLPLMGWTCCPRPCS
ELFPLIPNDYLLSWLLFIAFLFSGIIYTYGHVLWKAHQHVASLSGHQDRQVPGMARMRLD
VRLAKTLGLVLAVLLICWFPVLALMAHSLATTLSDQVKKAFAFCSMLCLINSMVNPVIYA
LRSGEIRSSAHHCLAHWKKCVRGLGSEAKEEAPRSSVTETEADGKITPWPDSRDLDLSDC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50272598
NameBDBM50272598
Synonyms:6-Methoxy-5-(2-morpholin-4-yl-ethyl)-2-(1,3,3-trimethyl-bicyclo[2.2.1]hept-2-yl)-2,5-dihydro-pyrido[4,3-b]indol-1-one | 6-methoxy-5-(2-morpholinoethyl)-2-((1S,2S,4R)-1,3,3-trimethylbicyclo[2.2.1]heptan-2-yl)-2H-pyrido[4,3-b]indol-1(5H)-one | CHEMBL527031
TypeSmall organic molecule
Emp. Form.C28H37N3O3
Mol. Mass.463.6117
SMILESCOc1cccc2c1n(CCN1CCOCC1)c1ccn([C@H]3[C@@]4(C)CC[C@H](C4)C3(C)C)c(=O)c21 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a