Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLiver fatty acid binding protein (rat L-FABP)
LigandBDBM50074922
Substrate/Competitorn/a
Meas. Tech.ChEMBL_555398
Ki 222000±n/a nM
Citation Chuang, SVelkov, THorne, JPorter, CJScanlon, MJ Characterization of the drug binding specificity of rat liver fatty acid binding protein. J Med Chem51:3755-64 (2008) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Liver fatty acid binding protein (rat L-FABP)
Name:Liver fatty acid binding protein (rat L-FABP)
Synonyms:FABP1 | Fatty acid-binding protein, liver
Type:Protein
Mol. Mass.:14274.39
Organism:Rattus norvegicus (Rat)
Description:rat L-FABP
Residue:127
Sequence:
MNFSGKYQVQSQENFEPFMKAMGLPEDLIQKGKDIKGVSEIVHEGKKVKLTITYGSKVIH
NEFTLGEECELETMTGEKVKAVVKMEGDNKMVTTFKGIKSVTEFNGDTITNTMTLGDIVY
KRVSKRI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50074922
NameBDBM50074922
Synonyms:(+-)-2-fluoro-alpha-methyl-4-biphenylacetic acid | 2-(2-fluoro-[1,1'-biphenyl-4-yl])propanoic acid | 2-(2-fluorobiphenyl-4-yl)propanoic acid | 2-fluoro-alpha-methyl-(1,1'-biphenyl)-4-acetic acid | 3-fluoro-4-phenylhydratropic acid | Ansaid | CHEMBL563 | FLURBIPROFEN | US9630914, Compound A
TypeSmall organic molecule
Emp. Form.C15H13FO2
Mol. Mass.244.2609
SMILESCC(C(O)=O)c1ccc(c(F)c1)-c1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a