Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetGlutamate receptor ionotropic, AMPA 4
LigandBDBM50061058
Substrate/Competitorn/a
Meas. Tech.ChEMBL_539474
Ki 14200±n/a nM
Citation Butini, SPickering, DSMorelli, ECoccone, SSTrotta, FDe Angelis, MGuarino, EFiorini, ICampiani, GNovellino, ESchousboe, AChristensen, JKGemma, S 1H-cyclopentapyrimidine-2,4(1H,3H)-dione-related ionotropic glutamate receptors ligands. structure-activity relationships and identification of potent and Selective iGluR5 modulators. J Med Chem51:6614-8 (2008) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Glutamate receptor ionotropic, AMPA 4
Name:Glutamate receptor ionotropic, AMPA 4
Synonyms:Glutamate receptors NMDA/AMPA
Type:PROTEIN
Mol. Mass.:100766.57
Organism:Rattus norvegicus
Description:ChEMBL_539474
Residue:902
Sequence:
MRIICRQIVLLFSGFWGLAMGAFPSSVQIGGLFIRNTDQEYTAFRLAIFLHNTSPNASEA
PFNLVPHVDNIETANSFAVTNAFCSQYSRGVFAIFGLYDKRSVHTLTSFCSALHISLITP
SFPTEGESQFVLQLRPSLRGALLSLLDHYEWNCFVFLYDTDRGYSILQAIMEKAGQNGWH
VSAICVENFNDVSYRQLLEELDRRQEKKFVIDCEIERLQNILEQIVSVGKHVKGYHYIIA
NLGFKDISLERFIHGGANVTGFQLVDFNTPMVTKLMDRWKKLDQREYPGSETPPKYTSAL
TYDGVLVMAETFRSLRRQKIDISRRGNAGDCLANPAAPWGQGIDMERTLKQVRIQGLTGN
VQFDHYGRRVNYTMDVFELKSTGPRKVGYWNDMDKLVLIQDMPTLGNDTAAIENRTVVVT
TIMESPYVMYKKNHEMFEGNDKYEGYCVDLASEIAKHIGIKYKIAIVPDGKYGARDADTK
IWNGMVGELVYGKAEIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFL
DPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHTEEPEDGKEGPSDQPPNEFGIFNSLW
FSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAED
LAKQTEIAYGTLDSGSTKEFFRRSKIAVYEKMWTYMRSAEPSVFTRTTAEGVARVRKSKG
KFAFLLESTMNEYTEQRKPCDTMKVGGNLDSKGYGVATPKGSSLGNAVNLAVLKLNEQGL
LDKLKNKWWYDKGECGSGGGDSKDKTSALSLSNVAGVFYILVGGLGLAMLVALIEFCYKS
RAEAKRMKLTFSEATRNKARLSITGSVGENGRVLTPDCPKAVHTGTAIRQSSGLAVIASD
LP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50061058
NameBDBM50061058
Synonyms:2-Amino-3-(2,4-dihydroxy-pyrimidin-1-yl)-propionic acid(DL-willardiine) | 2-amino-3-(2,4-dioxo-3,4-dihydropyrimidin-1(2H)-yl)propanoic acid | CHEMBL366489
TypeSmall organic molecule
Emp. Form.C7H9N3O4
Mol. Mass.199.1641
SMILESNC(Cn1ccc(=O)[nH]c1=O)C(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a