Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetNeuronal acetylcholine receptor
LigandBDBM50275262
Substrate/Competitorn/a
Meas. Tech.ChEMBL_494699
Ki>1000000±n/a nM
Citation Hansen, CPJensen, AAChristensen, JKBalle, TLiljefors, TFrølund, B Novel acetylcholine and carbamoylcholine analogues: development of a functionally selective alpha4beta2 nicotinic acetylcholine receptor agonist. J Med Chem51:7380-95 (2009) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Neuronal acetylcholine receptor
Name:Neuronal acetylcholine receptor
Synonyms:Cholinergic, Nicotinic Alpha7 | Cholinergic, Nicotinic Alpha7/5-HT3 | Neuronal acetylcholine receptor (alpha7 nAChR) | Neuronal acetylcholine receptor subunit alpha 7 | Neuronal acetylcholine receptor subunit alpha-7 | Neuronal acetylcholine receptor subunit alpha-7 (nAChR alpha7) | Neuronal acetylcholine receptor subunit alpha-7 (nAChR)
Type:Enzyme
Mol. Mass.:56502.44
Organism:Rattus norvegicus (Rat)
Description:Q05941
Residue:502
Sequence:
MCGGRGGIWLALAAALLHVSLQGEFQRRLYKELVKNYNPLERPVANDSQPLTVYFSLSLL
QIMDVDEKNQVLTTNIWLQMSWTDHYLQWNMSEYPGVKNVRFPDGQIWKPDILLYNSADE
RFDATFHTNVLVNASGHCQYLPPGIFKSSCYIDVRWFPFDVQQCKLKFGSWSYGGWSLDL
QMQEADISSYIPNGEWDLMGIPGKRNEKFYECCKEPYPDVTYTVTMRRRTLYYGLNLLIP
CVLISALALLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAQYFAST
MIIVGLSVVVTVIVLRYHHHDPDGGKMPKWTRIILLNWCAWFLRMKRPGEDKVRPACQHK
PRRCSLASVELSAGAGPPTSNGNLLYIGFRGLEGMHCAPTPDSGVVCGRLACSPTHDEHL
MHGAHPSDGDPDLAKILEEVRYIANRFRCQDESEVICSEWKFAACVVDRLCLMAFSVFTI
ICTIGILMSAPNFVEAVSKDFA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50275262
NameBDBM50275262
Synonyms:3-(dimethylamino)butyl dimethylcarbamate | 3-N,N-dimethylaminobutyl-N,N-dimethylcarbamate | CHEMBL486572
TypeSmall organic molecule
Emp. Form.C9H20N2O2
Mol. Mass.188.2673
SMILESCC(CCOC(=O)N(C)C)N(C)C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a