Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCarbonic anhydrase
LigandBDBM10873
Substrate/Competitorn/a
Meas. Tech.ChEMBL_515851
Ki 15.1±n/a nM
Citation Isik, SKockar, FAydin, MArslan, OGuler, OOInnocenti, AScozzafava, ASupuran, CT Carbonic anhydrase inhibitors: inhibition of the beta-class enzyme from the yeast Saccharomyces cerevisiae with sulfonamides and sulfamates. Bioorg Med Chem17:1158-63 (2009) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Carbonic anhydrase
Name:Carbonic anhydrase
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:24861.97
Organism:Saccharomyces cerevisiae
Description:ChEMBL_1507033
Residue:221
Sequence:
MSATESSSIFTLSHNSNLQDILAANAKWASQMNNIQPTLFPDHNAKGQSPHTLFIGCSDS
RYNENCLGVLPGEVFTWKNVANICHSEDLTLKATLEFAIICLKVNKVIICGHTDCGGIKT
CLTNQREALPKVNCSHLYKYLDDIDTMYHEESQNLIHLKTQREKSHYLSHCNVKRQFNRI
IENPTVQTAVQNGELQVYGLLYNVEDGLLQTVSTYTKVTPK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM10873
NameBDBM10873
Synonyms:4-[(2-aminopyrimidin-4-yl)amino]benzene-1-sulfonamide | CHEMBL6633 | US9616064, Compound 1aa | aromatic/heteroaromatic sulfonamide 18
TypeSmall organic molecule
Emp. Form.C10H11N5O2S
Mol. Mass.265.292
SMILESNc1nccc(Nc2ccc(cc2)S(N)(=O)=O)n1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a