Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMeiotic mRNA stability protein kinase SSN3
LigandBDBM50113707
Substrate/Competitorn/a
Meas. Tech.ChEMBL_563815
IC50>500000±n/a nM
Citation Gray, NSWodicka, LThunnissen, AMNorman, TCKwon, SEspinoza, FHMorgan, DOBarnes, GLeClerc, SMeijer, LKim, SHLockhart, DJSchultz, PG Exploiting chemical libraries, structure, and genomics in the search for kinase inhibitors. Science281:533-538 (1998) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Meiotic mRNA stability protein kinase SSN3
Name:Meiotic mRNA stability protein kinase SSN3
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:62879.98
Organism:Saccharomyces cerevisiae
Description:ChEMBL_563815
Residue:555
Sequence:
MYNGKDRAQNSYQPMYQRPMQVQGQQQAQSFVGKKNTIGSVHGKAPMLMANNDVFTIGPY
RARKDRMRVSVLEKYEVIGYIAAGTYGKVYKAKRQINSGTNSANGSSLNGTNAKIPQFDS
TQPKSSSSMDMQANTNALRRNLLKDEGVTPGRIRTTREDVSPHYNSQKQTLIKKPLTVFY
AIKKFKTEKDGVEQLHYTGISQSACREMALCRELHNKHLTTLVEIFLERKCVHMVYEYAE
HDLLQIIHFHSHPEKRMIPPRMVRSIMWQLLDGVSYLHQNWVLHRDLKPANIMVTIDGCV
KIGDLGLARKFHNMLQTLYTGDKVVVTIWYRAPELLLGARHYTPAVDLWSVGCIFAELIG
LQPIFKGEEAKLDSKKTVPFQVNQLQRILEVLGTPDQKIWPYLEKYPEYDQITKFPKYRD
NLATWYHSAGGRDKHALSLLYHLLNYDPIKRIDAFNALEHKYFTESDIPVSENVFEGLTY
KYPARRIHTNDNDIMNLGSRTKNNTQASGITAGAAANALGGLGVNRRILAAAAAAAAAVS
GNNASDEPSRKKNRR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50113707
NameBDBM50113707
Synonyms:2,6,9-Trisubstitute purine, 2 | 2-(2-hydroxyethylamino)-6-(3-chloroanilino)-9-isopropylpurine | 2-[6-(3-Chloro-phenylamino)-9-isopropyl-9H-purin-2-ylamino]-ethanol | CHEMBL311228
TypeSmall organic molecule
Emp. Form.C16H19ClN6O
Mol. Mass.346.815
SMILESCC(C)n1cnc2c(Nc3cccc(Cl)c3)nc(NCCO)nc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a