Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAdenosine A2b receptor
LigandBDBM50268232
Substrate/Competitorn/a
Meas. Tech.ChEMBL_520205
Kd 0.351±n/a nM
Citation Borrmann, THinz, SBertarelli, DCLi, WFlorin, NCScheiff, ABMüller, CE 1-alkyl-8-(piperazine-1-sulfonyl)phenylxanthines: development and characterization of adenosine A2B receptor antagonists and a new radioligand with subnanomolar affinity and subtype specificity. J Med Chem52:3994-4006 (2009) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Adenosine A2b receptor
Name:Adenosine A2b receptor
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:36130.09
Organism:Mus musculus
Description:ChEMBL_11831
Residue:332
Sequence:
MQLETQDALYVALELVIAALAVAGNVLVCAAVGASSALQTPTNYFLVSLATADVAVGLFA
IPFAITISLGFCTDFHGCLFLACFVLVLTQSSIFSLLAVAVDRYLAIRVPLRYKGLVTGT
RARGIIAVLWVLAFGIGLTPFLGWNSKDSATSNCTELGDGIANKSCCPVTCLFENVVPMS
YMVYFNFFGCVLPPLLIMLVIYIKIFMVACKQLQRMELMDHSRTTLQREIHAAKSLAMIV
GIFALCWLPVHAINCITLFHPALAKDKPKWVMNVAILLSHANSVVNPIVYAYRNRDFRYS
FHKIISRYVLCQAETKGGSGQAGAQSTLSLGL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50268232
NameBDBM50268232
Synonyms:8-(4-(4-(4-Chlorophenyl)piperazine-1-sulfonyl)phenyl)-1-propyl-3,7-dihydropurine-2,6-dione | CHEMBL483688
TypeSmall organic molecule
Emp. Form.C24H25ClN6O4S
Mol. Mass.529.011
SMILESCCCn1c(=O)[nH]c2nc([nH]c2c1=O)-c1ccc(cc1)S(=O)(=O)N1CCN(CC1)c1ccc(Cl)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a