Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target5'-AMP-activated protein kinase catalytic subunit alpha-1
LigandBDBM26300
Substrate/Competitorn/a
Meas. Tech.ChEMBL_586314
Kd>10000±n/a nM
Citation Karaman, MWHerrgard, STreiber, DKGallant, PAtteridge, CECampbell, BTChan, KWCiceri, PDavis, MIEdeen, PTFaraoni, RFloyd, MHunt, JPLockhart, DJMilanov, ZVMorrison, MJPallares, GPatel, HKPritchard, SWodicka, LMZarrinkar, PP A quantitative analysis of kinase inhibitor selectivity. Nat Biotechnol26:127-32 (2008) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
5'-AMP-activated protein kinase catalytic subunit alpha-1
Name:5'-AMP-activated protein kinase catalytic subunit alpha-1
Synonyms:5''-AMP-activated protein kinase catalytic subunit alpha-1 (AMPKa1) | 5''-AMP-activated protein kinase subunit alpha-1 | ACACA kinase | AMP-activated protein kinase, alpha-1 subunit | AMPK subunit alpha-1 | AMPK-alpha1 | Hydroxymethylglutaryl-CoA reductase kinase | Tau-protein kinase PRKAA1
Type:Protein
Mol. Mass.:64023.62
Organism:Homo sapiens (Human)
Description:Q13131
Residue:559
Sequence:
MRRLSSWRKMATAEKQKHDGRVKIGHYILGDTLGVGTFGKVKVGKHELTGHKVAVKILNR
QKIRSLDVVGKIRREIQNLKLFRHPHIIKLYQVISTPSDIFMVMEYVSGGELFDYICKNG
RLDEKESRRLFQQILSGVDYCHRHMVVHRDLKPENVLLDAHMNAKIADFGLSNMMSDGEF
LRTSCGSPNYAAPEVISGRLYAGPEVDIWSSGVILYALLCGTLPFDDDHVPTLFKKICDG
IFYTPQYLNPSVISLLKHMLQVDPMKRATIKDIREHEWFKQDLPKYLFPEDPSYSSTMID
DEALKEVCEKFECSEEEVLSCLYNRNHQDPLAVAYHLIIDNRRIMNEAKDFYLATSPPDS
FLDDHHLTRPHPERVPFLVAETPRARHTLDELNPQKSKHQGVRKAKWHLGIRSQSRPNDI
MAEVCRAIKQLDYEWKVVNPYYLRVRRKNPVTSTYSKMSLQLYQVDSRTYLLDFRSIDDE
ITEAKSGTATPQRSGSVSNYRSCQRSDSDAEAQGKSSEVSLTSSVTSLDSSPVDLTPRPG
SHTIEFFEMCANLIKILAQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM26300
NameBDBM26300
Synonyms:2-{3-[(7-{3-[ethyl(2-hydroxyethyl)amino]propoxy}quinazolin-4-yl)amino]-1H-pyrazol-5-yl}-N-(3-fluorophenyl)acetamide | CHEMBL215152 | cid_16007391 | pyrazoloquinazoline deriv., 34
TypeSmall organic molecule
Emp. Form.C26H30FN7O3
Mol. Mass.507.5599
SMILESCCN(CCO)CCCOc1ccc2c(Nc3cc(CC(=O)Nc4cccc(F)c4)n[nH]3)ncnc2c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a