Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSerine/threonine-protein kinase 32B
LigandBDBM5447
Substrate/Competitorn/a
Meas. Tech.ChEMBL_587221
Kd>10000±n/a nM
Citation Karaman, MWHerrgard, STreiber, DKGallant, PAtteridge, CECampbell, BTChan, KWCiceri, PDavis, MIEdeen, PTFaraoni, RFloyd, MHunt, JPLockhart, DJMilanov, ZVMorrison, MJPallares, GPatel, HKPritchard, SWodicka, LMZarrinkar, PP A quantitative analysis of kinase inhibitor selectivity. Nat Biotechnol26:127-32 (2008) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Serine/threonine-protein kinase 32B
Name:Serine/threonine-protein kinase 32B
Synonyms:YANK2
Type:PROTEIN
Mol. Mass.:47892.49
Organism:Homo sapiens
Description:ChEMBL_587221
Residue:414
Sequence:
MGGNHSHKPPVFDENEEVNFDHFQILRAIGKGSFGKVCIVQKRDTKKMYAMKYMNKQKCI
ERDEVRNVFRELQIMQGLEHPFLVNLWYSFQDEEDMFMVVDLLLGGDLRYHLQQNVHFTE
GTVKLYICELALALEYLQRYHIIHRDIKPDNILLDEHGHVHITDFNIATVVKGAERASSM
AGTKPYMAPEVFQVYMDRGPGYSYPVDWWSLGITAYELLRGWRPYEIHSVTPIDEILNMF
KVERVHYSSTWCKGMVALLRKLLTKDPESRVSSLHDIQSVPYLADMNWDAVFKKALMPGF
VPNKGRLNCDPTFELEEMILESKPLHKKKKRLAKNRSRDGTKDSCPLNGHLQHCLETVRE
EFIIFNREKLRRQQGQGSQLLDTDSRGGGQAQSKLQDGCNNNLLTHTCTRGCSS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM5447
n/a
NameBDBM5447
Synonyms:CHEMBL939 | GEFITINIB | Iressa | N-(3-Chloro-4-fluorophenyl)-7-methoxy-6-[3-(4-morpholinyl)propoxy]-4-quinazolinamine | N-(3-chloro-4-fluorophenyl)-7-methoxy-6-[3-(morpholin-4-yl)propoxy]quinazolin-4-amine | US9416123, Gefitinib | ZD1839 | cid_123631
TypeSmall organic molecule
Emp. Form.C22H24ClFN4O3
Mol. Mass.446.902
SMILESCOc1cc2ncnc(Nc3ccc(F)c(Cl)c3)c2cc1OCCCN1CCOCC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: