Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAlpha carbonic anhydrase
LigandBDBM10880
Substrate/Competitorn/a
Meas. Tech.ChEMBL_587743
Ki 16±n/a nM
Citation Bertucci, AInnocenti, AZoccola, DScozzafava, ATambutté, SSupuran, CT Carbonic anhydrase inhibitors. Inhibition studies of a coral secretory isoform by sulfonamides. Bioorg Med Chem17:5054-8 (2009) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Alpha carbonic anhydrase
Name:Alpha carbonic anhydrase
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:36650.57
Organism:Stylophora pistillata
Description:ChEMBL_700658
Residue:323
Sequence:
MKLSLFISSLLAMIVACPNLAESAGSWTYRDPEGPDTWKHHYKDCEGHEQSPINIVPKDT
FFEPGLADLVVNYEKSVSAKLFNNGHTVQATFLTGKSNISGGNLTSHFRALQMHFHWGSE
NSRGSEHQVGGRKFPLEIHIVHYNAEKYPSVSEAVDKGDGLAVLGILVELQVQDNPVFDV
MVDNLDKARYKGNEVILPSLQPFSFLPHDIAQYYTYRGSLTTPGCFESVQWFVFNHTFPI
SQAQLDKFRDLFDSEKQDTKKLPLVDNYRPVQPLYGRSVSEASNALLFPVARHQTKLWIA
WDSLMTRQYFMKQQSICALYQPQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM10880
NameBDBM10880
Synonyms:AZA | AZA2 | AZM acetazolamide | Acerazolamide, AAZ | Acetazolamide | Acetazolamide (AAZ) | Acetazolamide (AZA) | Acetazolamide (AZM) | Acetazolamide, 5 | Acetazolamide, AAZ | Acetazolamide, AZA | Acetazolamide, AZM | CHEMBL20 | N-(5-sulfamoyl-1,3,4-thiadiazol-2-yl)acetamide | Sulfonamide, 1 | US10172837, Acetazolamide | sulfonamide 1
TypeSmall organic molecule
Emp. Form.C4H6N4O3S2
Mol. Mass.222.245
SMILESCC(=O)Nc1nnc(s1)S(N)(=O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a