Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAlpha carbonic anhydrase
LigandBDBM10884
Substrate/Competitorn/a
Meas. Tech.ChEMBL_587743
Ki 18.1±n/a nM
Citation Bertucci, AInnocenti, AZoccola, DScozzafava, ATambutté, SSupuran, CT Carbonic anhydrase inhibitors. Inhibition studies of a coral secretory isoform by sulfonamides. Bioorg Med Chem17:5054-8 (2009) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Alpha carbonic anhydrase
Name:Alpha carbonic anhydrase
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:36650.57
Organism:Stylophora pistillata
Description:ChEMBL_700658
Residue:323
Sequence:
MKLSLFISSLLAMIVACPNLAESAGSWTYRDPEGPDTWKHHYKDCEGHEQSPINIVPKDT
FFEPGLADLVVNYEKSVSAKLFNNGHTVQATFLTGKSNISGGNLTSHFRALQMHFHWGSE
NSRGSEHQVGGRKFPLEIHIVHYNAEKYPSVSEAVDKGDGLAVLGILVELQVQDNPVFDV
MVDNLDKARYKGNEVILPSLQPFSFLPHDIAQYYTYRGSLTTPGCFESVQWFVFNHTFPI
SQAQLDKFRDLFDSEKQDTKKLPLVDNYRPVQPLYGRSVSEASNALLFPVARHQTKLWIA
WDSLMTRQYFMKQQSICALYQPQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM10884
NameBDBM10884
Synonyms:(2S,4S)-4-(ethylamino)-2-methyl-1,1-dioxo-2H,3H,4H-1,7-thieno[2,3-b]thiopyran-6-sulfonamide | Dorzolamide (DRZ) | Dorzolamide (DZA)
TypeSmall organic molecule
Emp. Form.C10H16N2O4S3
Mol. Mass.324.44
SMILESCCN[C@H]1C[C@H](C)S(=O)(=O)c2sc(cc12)S(N)(=O)=O |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a