Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDopamine D5 receptor
LigandBDBM50160160
Substrate/Competitorn/a
Meas. Tech.ChEMBL_604290
Ki 2397±n/a nM
Citation Legendre, OPecic, SChaudhary, SZimmerman, SMFantegrossi, WEHarding, WW Synthetic studies and pharmacological evaluations on the MDMA ('Ecstasy') antagonist nantenine. Bioorg Med Chem Lett20:628-31 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Dopamine D5 receptor
Name:Dopamine receptor
Synonyms:D(1B) dopamine receptor | D(5) dopamine receptor | D1beta dopamine receptor | DOPAMINE D5 | DRD5 | Dopamine receptor | dopamine receptor D5
Type:Protein
Mol. Mass.:52943.41
Organism:Homo sapiens (Human)
Description:P21918
Residue:477
Sequence:
MLPPGSNGTAYPGQFALYQQLAQGNAVGGSAGAPPLGPSQVVTACLLTLLIIWTLLGNVL
VCAAIVRSRHLRANMTNVFIVSLAVSDLFVALLVMPWKAVAEVAGYWPFGAFCDVWVAFD
IMCSTASILNLCVISVDRYWAISRPFRYKRKMTQRMALVMVGLAWTLSILISFIPVQLNW
HRDQAASWGGLDLPNNLANWTPWEEDFWEPDVNAENCDSSLNRTYAISSSLISFYIPVAI
MIVTYTRIYRIAQVQIRRISSLERAAEHAQSCRSSAACAPDTSLRASIKKETKVLKTLSV
IMGVFVCCWLPFFILNCMVPFCSGHPEGPPAGFPCVSETTFDVFVWFGWANSSLNPVIYA
FNADFQKVFAQLLGCSHFCSRTPVETVNISNELISYNQDIVFHKEIAAAYIHMMPNAVTP
GNREVDNDEEEGPFDRMFQIYQTSPDGDPVAESVWELDCEGEISLDKITPFTPNGFH
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50160160
NameBDBM50160160
Synonyms:(S)-1,2-Dimethoxy-6-methyl-5,6,6a,7-tetrahydro-4H-9,11-dioxa-6-aza-benzo[fg]cyclopenta[b]anthracene | CHEMBL179440
TypeSmall organic molecule
Emp. Form.C20H21NO4
Mol. Mass.339.385
SMILESCOc1cc2CCN(C)[C@H]3Cc4cc5OCOc5cc4-c(c1OC)c23
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a