Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAcidic fibroblast growth factor
LigandBDBM50307401
Substrate/Competitorn/a
Meas. Tech.ChEMBL_610685
Kd 118±n/a nM
Citation Johnstone, KDKaroli, TLiu, LDredge, KCopeman, ELi, CPDavis, KHammond, EBytheway, IKostewicz, EChiu, FCShackleford, DMCharman, SACharman, WNHarenberg, JGonda, TJFerro, V Synthesis and biological evaluation of polysulfated oligosaccharide glycosides as inhibitors of angiogenesis and tumor growth. J Med Chem53:1686-99 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Acidic fibroblast growth factor
Name:Acidic fibroblast growth factor
Synonyms:Acidic fibroblast growth factor | Beta-endothelial cell growth factor | ECGF-beta | Fibroblast growth factor 1 (FGF-1) | HBGF-1 | Heparin-binding growth factor 1 | aFGF
Type:Protein
Mol. Mass.:17461.01
Organism:Homo sapiens (Human)
Description:P05230
Residue:155
Sequence:
MAEGEITTFTALTEKFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQ
LSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEK
NWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50307401
NameBDBM50307401
Synonyms:CHEMBL602113 | Octyl 2,3,4,6-Tetra-O-sulfo-alpha-D-mannopyranosyl-(1->3)-2,4,6-tri-O-sulfo-alpha-D-mannopyranosyl-(1->3)-2,4,6-tri-O-sulfo-alpha-D-mannopyranosyl-(1->2)-3,4,6-tri-O-sulfo-alpha-D-mannopyranoside, TridecasodiumSalt
TypeSmall organic molecule
Emp. Form.C32H45O60S13
Mol. Mass.1806.516
SMILESCCCCCCCCO[C@H]1O[C@H](COS([O-])(=O)=O)[C@@H](OS([O-])(=O)=O)[C@H](OS([O-])(=O)=O)[C@@H]1O[C@H]1O[C@H](COS([O-])(=O)=O)[C@@H](OS([O-])(=O)=O)[C@H](O[C@H]2O[C@H](COS([O-])(=O)=O)[C@@H](OS([O-])(=O)=O)[C@H](O[C@H]3O[C@H](COS([O-])(=O)=O)[C@@H](OS([O-])(=O)=O)[C@H](OS([O-])(=O)=O)[C@@H]3OS([O-])(=O)=O)[C@@H]2OS([O-])(=O)=O)[C@@H]1OS([O-])(=O)=O |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a