Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCyclin-dependent kinase 4
LigandBDBM7262
Substrate/Competitorn/a
Meas. Tech.ChEMBL_660568
IC50>10000±n/a nM
Citation Sridhar, JAkula, NPattabiraman, N Selectivity and potency of cyclin-dependent kinase inhibitors. AAPS J8:204-21 (2006) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Cyclin-dependent kinase 4
Name:Cyclin-dependent kinase 4/G1/S-specific cyclin-E1
Synonyms:CDK4 | Cell division protein kinase 4 | Cyclin-dependent kinase 4 (CDK 4) | PSK-J3
Type:Enzyme Subunit
Mol. Mass.:33731.96
Organism:Homo sapiens (human)
Description:P11802
Residue:303
Sequence:
MATSRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGGGGGGLPISTVREVALL
RRLEAFEHPNVVRLMDVCATSRTDREIKVTLVFEHVDQDLRTYLDKAPPPGLPAETIKDL
MRQFLRGLDFLHANCIVHRDLKPENILVTSGGTVKLADFGLARIYSYQMALTPVVVTLWY
RAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPR
DVSLPRGAFPPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKDEG
NPE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM7262
NameBDBM7262
Synonyms:14-nitro-8,18-diazatetracyclo[9.7.0.0^{2,7}.0^{12,17}]octadeca-1(11),2,4,6,12(17),13,15-heptaen-9-one | 9-Nitropaullone | CHEMBL50894 | NSC 705701 | Paullone Analog 1 | alsterpaullone
TypeSmall organic molecule
Emp. Form.C16H11N3O3
Mol. Mass.293.2768
SMILES[O-][N+](=O)c1ccc2[nH]c-3c(CC(=O)Nc4ccccc-34)c2c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a