Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCarbonic Anhydrase VA
LigandBDBM26980
Substrate/Competitorn/a
Meas. Tech.ChEMBL_700697
Ki 50000000±n/a nM
Citation Ekinci, DCeyhun, SBSentürk, MErdem, DKüfrevioglu, OISupuran, CT Characterization and anions inhibition studies of ana-carbonic anhydrase from the teleost fish Dicentrarchus labrax. Bioorg Med Chem19:744-8 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Carbonic Anhydrase VA
Name:Carbonic anhydrase V
Synonyms:CA-VA | Carbonate dehydratase VA | Carbonic anhydrase 5A (CA VA) | Carbonic anhydrase 5A, mitochondrial | Carbonic anhydrase 5A, mitochondrial precursor | Carbonic anhydrase VA (CA VA)
Type:Enzyme
Mol. Mass.:34755.54
Organism:Homo sapiens (Human)
Description:Human (cloned) isozyme
Residue:305
Sequence:
MLGRNTWKTSAFSFLVEQMWAPLWSRSMRPGRWCSQRSCAWQTSNNTLHPLWTVPVSVPG
GTRQSPINIQWRDSVYDPQLKPLRVSYEAASCLYIWNTGYLFQVEFDDATEASGISGGPL
ENHYRLKQFHFHWGAVNEGGSEHTVDGHAYPAELHLVHWNSVKYQNYKEAVVGENGLAVI
GVFLKLGAHHQTLQRLVDILPEIKHKDARAAMRPFDPSTLLPTCWDYWTYAGSLTTPPLT
ESVTWIIQKEPVEVAPSQLSAFRTLLFSALGEEEKMMVNNYRPLQPLMNRKVWASFQATN
EGTRS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM26980
NameBDBM26980
Synonyms:BROMIDE | Br- | CHEMBL11685 | CHEMBL1644030 | CHEMBL1644694 | bromide | bromide ion
TypeIon
Emp. Form.Br
Mol. Mass.79.905
SMILES[Br-]
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a