Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPeripheral-Type Benzodiazepine Receptor
LigandBDBM50335259
Substrate/Competitorn/a
Meas. Tech.ChEMBL_702766
Ki 0.3±n/a nM
Citation Pike, VWTaliani, SLohith, TGOwen, DRPugliesi, IDa Pozzo, EHong, JZoghbi, SSGunn, RNParker, CARabiner, EAFujita, MInnis, RBMartini, CDa Settimo, F Evaluation of novel N1-methyl-2-phenylindol-3-ylglyoxylamides as a new chemotype of 18 kDa translocator protein-selective ligand suitable for the development of positron emission tomography radioligands. J Med Chem54:366-73 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Peripheral-Type Benzodiazepine Receptor
Name:Benzodiazepine receptors; peripheral & central
Synonyms:Mitochondrial benzodiazepine receptor | PBR | PKBS | Peripheral benzodiazepine receptor (PBR)
Type:Mitochondrion membrane protein
Mol. Mass.:18945.84
Organism:Rattus norvegicus (rat)
Description:Competitive binding experiments were performed on rat kidney mitochondrial membranes.
Residue:169
Sequence:
MSQSWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAM
GYGSYIIWKELGGFTEEAMVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLMLVSGVAT
ATTLAWHRVSPPAARLLYPYLAWLAFATMLNYYVWRDNSGRRGGSRLTE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50335259
NameBDBM50335259
Synonyms:CHEMBL1651225 | N,N-dibutyl-2-(1-methyl-2-phenyl-1H-indol-3-yl)-2-oxoacetamide
TypeSmall organic molecule
Emp. Form.C25H30N2O2
Mol. Mass.390.5179
SMILESCCCCN(CCCC)C(=O)C(=O)c1c(-c2ccccc2)n(C)c2ccccc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a