Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDihydrofolate Reductase (DHFR)
LigandBDBM18050
Substrate/Competitorn/a
Meas. Tech.ChEMBL_710363
IC50 12.2±n/a nM
Citation Bourne, CRBunce, RABourne, PCBerlin, KDBarrow, EWBarrow, WW Crystal structure of Bacillus anthracis dihydrofolate reductase with the dihydrophthalazine-based trimethoprim derivative RAB1 provides a structural explanation of potency and selectivity. Antimicrob Agents Chemother53:3065-73 (2009) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Dihydrofolate Reductase (DHFR)
Name:Dihydrofolate Reductase (DHFR)
Synonyms:baDHFR
Type:Enzyme
Mol. Mass.:19120.62
Organism:Bacillus anthracis
Description:baDHFR was expressed in E. coli BL21, and purified to homogeneity.
Residue:162
Sequence:
MIVSFMVAMDENRVIGKDNNLPWRLPSELQYVKKTTMGHPLIMGRKNYEAIGRPLPGRRN
IIVTRNEGYHVEGCEVAHSVEEVFELCKNEEEIFIFGGAQIYDLFLPYVDKLYITKIHHA
FEGDTFFPEMDMTNWKEVFVEKGLTDEKNPYTYYYHVYEKQQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM18050
NameBDBM18050
Synonyms:2-[(4-{[(2,4-diaminopteridin-6-yl)methyl](methyl)amino}phenyl)formamido]pentanedioic acid | CHEMBL34259 | METHOTREXATE | MTX | Methotrexate | cid_126941
TypeSmall organic molecule
Emp. Form.C20H22N8O5
Mol. Mass.454.4393
SMILESCN(Cc1cnc2nc(N)nc(N)c2n1)c1ccc(cc1)C(=O)N[C@@H](CCC(O)=O)C(O)=O |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a