Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCalmodulin-domain protein kinase 1 (CDPK1)
LigandBDBM50345741
Substrate/Competitorn/a
Meas. Tech.ChEMBL_750529
IC50 900±n/a nM
Citation Murphy, RCOjo, KKLarson, ETCastellanos-Gonzalez, APerera, BGKeyloun, KRKim, JEBhandari, JGMuller, NRVerlinde, CLWhite, ACMerritt, EAVan Voorhis, WCMaly, DJ Discovery of Potent and Selective Inhibitors of Calcium-Dependent Protein Kinase 1 (CDPK1) from C. parvum and T. gondii. ACS Med Chem Lett1:331-335 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Calmodulin-domain protein kinase 1 (CDPK1)
Name:Calmodulin-domain protein kinase 1 (CDPK1)
Synonyms:Calmodulin-domain protein kinase 1 | Calmodulin-domain protein kinase, putative
Type:Enzyme Catalytic Domain
Mol. Mass.:57248.42
Organism:Toxoplasma gondii
Description:n/a
Residue:507
Sequence:
MGQQESTLGGAAGEPRSRGHAAGTSGGPGDHLHATPGMFVQHSTAIFSDRYKGQRVLGKG
SFGEVILCKDKITGQECAVKVISKRQVKQKTDKESLLREVQLLKQLDHPNIMKLYEFFED
KGYFYLVGEVYTGGELFDEIISRKRFSEVDAARIIRQVLSGITYMHKNKIVHRDLKPENL
LLESKSKDANIRIIDFGLSTHFEASKKMKDKIGTAYYIAPEVLHGTYDEKCDVWSTGVIL
YILLSGCPPFNGANEYDILKKVEKGKYTFELPQWKKVSESAKDLIRKMLTYVPSMRISAR
DALDHEWIQTYTKEQISVDVPSLDNAILNIRQFQGTQKLAQAALLYMGSKLTSQDETKEL
TAIFHKMDKNGDGQLDRAELIEGYKELMRMKGQDASMLDASAVEHEVDQVLDAVDFDKNG
YIEYSEFVTVAMDRKTLLSRERLERAFRMFDSDNSGKISSTELATIFGVSDVDSETWKSV
LSEVDKNNDGEVDFDEFQQMLLKLCGN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50345741
NameBDBM50345741
Synonyms:1-isopropyl-3-(3-methoxynaphthalen-2-yl)-1H-pyrazolo[3,4-d]pyrimidin-4-amine | CHEMBL1785022 | US9765037, Compound 7s
TypeSmall organic molecule
Emp. Form.C19H19N5O
Mol. Mass.333.3871
SMILESCOc1cc2ccccc2cc1-c1nn(C(C)C)c2ncnc(N)c12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a