Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAmine oxidase [flavin-containing] B
LigandBDBM50350487
Substrate/Competitorn/a
Meas. Tech.ChEMBL_762552
IC50 16060±n/a nM
Citation Carroll, RTDluzen, DEStinnett, HAwale, PSFunk, MOGeldenhuys, WJ Structure-activity relationship and docking studies of thiazolidinedione-type compounds with monoamine oxidase B. Bioorg Med Chem Lett21:4798-803 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Amine oxidase [flavin-containing] B
Name:Amine oxidase [flavin-containing] B
Synonyms:MAO-B | Monoamine oxidase type B | Monoamine oxidase type B (MAO B) | Monoamine oxidase type B (MAO B) | Monoamine oxidase type B (MAOB)
Type:Protein
Mol. Mass.:58768.76
Organism:Homo sapiens (Human)
Description:P27338
Residue:520
Sequence:
MSNKCDVVVVGGGISGMAAAKLLHDSGLNVVVLEARDRVGGRTYTLRNQKVKYVDLGGSY
VGPTQNRILRLAKELGLETYKVNEVERLIHHVKGKSYPFRGPFPPVWNPITYLDHNNFWR
TMDDMGREIPSDAPWKAPLAEEWDNMTMKELLDKLCWTESAKQLATLFVNLCVTAETHEV
SALWFLWYVKQCGGTTRIISTTNGGQERKFVGGSGQVSERIMDLLGDRVKLERPVIYIDQ
TRENVLVETLNHEMYEAKYVISAIPPTLGMKIHFNPPLPMMRNQMITRVPLGSVIKCIVY
YKEPFWRKKDYCGTMIIDGEEAPVAYTLDDTKPEGNYAAIMGFILAHKARKLARLTKEER
LKKLCELYAKVLGSLEALEPVHYEEKNWCEEQYSGGCYTTYFPPGILTQYGRVLRQPVDR
IYFAGTETATHWSGYMEGAVEAGERAAREILHAMGKIPEDEIWQSEPESVDVPAQPITTT
FLERHLPSVPGLLRLIGLTTIFSATALGFLAHKRGLLVRV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50350487
NameBDBM50350487
Synonyms:CHEMBL1814635
TypeSmall organic molecule
Emp. Form.C12H13NO3S
Mol. Mass.251.302
SMILESCc1cc(Cc2sc(=O)[nH]c2O)cc(C)c1O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a
NameBDBM50350487
Synonyms:CHEMBL1814635
TypeSmall organic molecule
Emp. Form.C12H13NO3S
Mol. Mass.251.302
SMILESCc1cc(Cc2sc(=O)[nH]c2O)cc(C)c1O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: