Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target5'-AMP-activated protein kinase subunit beta-1
LigandBDBM50380246
Substrate/Competitorn/a
Meas. Tech.ChEMBL_813551
IC50>40000±n/a nM
Citation Maryanoff, BEMcComsey, DFYabut, SCLuci, DKJordan, ADMasucci, JAJones, WJAbad, MCGibbs, ACPetrounia, I Inhibitors of Ketohexokinase: Discovery of Pyrimidinopyrimidines with Specific Substitution that Complements the ATP-Binding Site. ACS Med Chem Lett2:538-543 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
5'-AMP-activated protein kinase subunit beta-1
Name:5'-AMP-activated protein kinase subunit beta-1
Synonyms:5'-AMP-activated protein kinase subunit beta-1 (AMPK) | 5''''''''-AMP-activated protein kinase subunit beta-1 | 5''''-AMP-activated protein kinase catalytic subunit alpha-2/beta-1/gamma-2 | 5''''-AMP-activated protein kinase subunit beta-1 | 5''-AMP-activated protein kinase subunit beta-1 | AMP-activated protein kinase, beta-1 subunit | AMPK | AMPK subunit beta-1 | AMPKb | PRKAB1
Type:n/a
Mol. Mass.:30380.94
Organism:Homo sapiens (Human)
Description:Q9Y478
Residue:270
Sequence:
MGNTSSERAALERHGGHKTPRRDSSGGTKDGDRPKILMDSPEDADLFHSEEIKAPEKEEF
LAWQHDLEVNDKAPAQARPTVFRWTGGGKEVYLSGSFNNWSKLPLTRSHNNFVAILDLPE
GEHQYKFFVDGQWTHDPSEPIVTSQLGTVNNIIQVKKTDFEVFDALMVDSQKCSDVSELS
SSPPGPYHQEPYVCKPEERFRAPPILPPHLLQVILNKDTGISCDPALLPEPNHVMLNHLY
ALSIKDGVMVLSATHRYKKKYVTTLLYKPI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50380246
NameBDBM50380246
Synonyms:CHEMBL2017214
TypeSmall organic molecule
Emp. Form.C21H26N8S
Mol. Mass.422.55
SMILESCSc1ccccc1Nc1nc(nc2c(NCC3CC3)ncnc12)N1CCNCC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a