Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCytochrome P450 2C9
LigandBDBM50380670
Substrate/Competitorn/a
Meas. Tech.ChEMBL_813215
IC50 1200±n/a nM
Citation Mirguet, OLamotte, YDonche, FToum, JGellibert, FBouillot, AGosmini, RNguyen, VLDelannée, DSeal, JBlandel, FBoullay, ABBoursier, EMartin, SBrusq, JMKrysa, GRiou, ATellier, RCostaz, AHuet, PDudit, YTrottet, LKirilovsky, JNicodeme, E From ApoA1 upregulation to BET family bromodomain inhibition: discovery of I-BET151. Bioorg Med Chem Lett22:2963-7 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Cytochrome P450 2C9
Name:Cytochrome P450 2C9
Synonyms:(R)-limonene 6-monooxygenase | (S)-limonene 6-monooxygenase | CYPIIC9 | Cytochrome P450 1A2 (CYP1A2) | Cytochrome P450 2C9 (CYP2C9 ) | Cytochrome P450 2C9 (CYP2C9) | P-450MP | P450 MP-4/MP-8 | P450 PB-1 | S-mephenytoin 4-hydroxylase
Type:Enzyme
Mol. Mass.:55636.33
Organism:Homo sapiens (Human)
Description:P11712
Residue:490
Sequence:
MDSLVVLVLCLSCLLLLSLWRQSSGRGKLPPGPTPLPVIGNILQIGIKDISKSLTNLSKV
YGPVFTLYFGLKPIVVLHGYEAVKEALIDLGEEFSGRGIFPLAERANRGFGIVFSNGKKW
KEIRRFSLMTLRNFGMGKRSIEDRVQEEARCLVEELRKTKASPCDPTFILGCAPCNVICS
IIFHKRFDYKDQQFLNLMEKLNENIKILSSPWIQICNNFSPIIDYFPGTHNKLLKNVAFM
KSYILEKVKEHQESMDMNNPQDFIDCFLMKMEKEKHNQPSEFTIESLENTAVDLFGAGTE
TTSTTLRYALLLLLKHPEVTAKVQEEIERVIGRNRSPCMQDRSHMPYTDAVVHEVQRYID
LLPTSLPHAVTCDIKFRNYLIPKGTTILISLTSVLHDNKEFPNPEMFDPHHFLDEGGNFK
KSKYFMPFSAGKRICVGEALAGMELFLFLTSILQNFNLKSLVDPKNLDTTPVVNGFASVP
PFYQLCFIPV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50380670
NameBDBM50380670
Synonyms:CHEMBL2017274
TypeSmall organic molecule
Emp. Form.C26H28N4O3
Mol. Mass.444.5255
SMILESCOc1cc2c(Nc3ccccc3C(C)(C)C)c(cnc2cc1-c1c(C)noc1C)C(N)=O |(23.31,-46.88,;23.31,-48.42,;24.65,-49.19,;25.97,-48.42,;27.31,-49.18,;28.64,-48.41,;28.63,-46.87,;27.29,-46.1,;25.97,-46.88,;24.64,-46.13,;24.62,-44.58,;25.96,-43.8,;27.29,-44.57,;28.62,-43.79,;29.96,-44.56,;28.62,-42.25,;29.95,-43.01,;29.97,-49.17,;29.98,-50.72,;28.65,-51.49,;27.31,-50.72,;25.98,-51.5,;24.64,-50.73,;23.31,-51.5,;23.27,-53.04,;24.5,-53.97,;21.8,-53.49,;20.92,-52.22,;21.85,-51,;21.4,-49.52,;31.3,-48.39,;32.64,-49.15,;31.29,-46.85,)|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a