Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCytochrome P450 2C9
LigandBDBM50380678
Substrate/Competitorn/a
Meas. Tech.ChEMBL_813215
IC50 1200±n/a nM
Citation Mirguet, OLamotte, YDonche, FToum, JGellibert, FBouillot, AGosmini, RNguyen, VLDelannée, DSeal, JBlandel, FBoullay, ABBoursier, EMartin, SBrusq, JMKrysa, GRiou, ATellier, RCostaz, AHuet, PDudit, YTrottet, LKirilovsky, JNicodeme, E From ApoA1 upregulation to BET family bromodomain inhibition: discovery of I-BET151. Bioorg Med Chem Lett22:2963-7 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Cytochrome P450 2C9
Name:Cytochrome P450 2C9
Synonyms:(R)-limonene 6-monooxygenase | (S)-limonene 6-monooxygenase | CYPIIC9 | Cytochrome P450 1A2 (CYP1A2) | Cytochrome P450 2C9 (CYP2C9 ) | Cytochrome P450 2C9 (CYP2C9) | P-450MP | P450 MP-4/MP-8 | P450 PB-1 | S-mephenytoin 4-hydroxylase
Type:Enzyme
Mol. Mass.:55636.33
Organism:Homo sapiens (Human)
Description:P11712
Residue:490
Sequence:
MDSLVVLVLCLSCLLLLSLWRQSSGRGKLPPGPTPLPVIGNILQIGIKDISKSLTNLSKV
YGPVFTLYFGLKPIVVLHGYEAVKEALIDLGEEFSGRGIFPLAERANRGFGIVFSNGKKW
KEIRRFSLMTLRNFGMGKRSIEDRVQEEARCLVEELRKTKASPCDPTFILGCAPCNVICS
IIFHKRFDYKDQQFLNLMEKLNENIKILSSPWIQICNNFSPIIDYFPGTHNKLLKNVAFM
KSYILEKVKEHQESMDMNNPQDFIDCFLMKMEKEKHNQPSEFTIESLENTAVDLFGAGTE
TTSTTLRYALLLLLKHPEVTAKVQEEIERVIGRNRSPCMQDRSHMPYTDAVVHEVQRYID
LLPTSLPHAVTCDIKFRNYLIPKGTTILISLTSVLHDNKEFPNPEMFDPHHFLDEGGNFK
KSKYFMPFSAGKRICVGEALAGMELFLFLTSILQNFNLKSLVDPKNLDTTPVVNGFASVP
PFYQLCFIPV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50380678
NameBDBM50380678
Synonyms:CHEMBL2017285
TypeSmall organic molecule
Emp. Form.C23H20N4O3
Mol. Mass.400.4299
SMILESCOc1cc2c3n(Cc4ccccc4)c(=O)[nH]c3cnc2cc1-c1c(C)noc1C |(31.17,-25.51,;31.17,-27.05,;32.5,-27.82,;33.83,-27.05,;35.16,-27.81,;36.49,-27.04,;36.8,-25.54,;36.03,-24.21,;36.8,-22.87,;38.33,-22.88,;39.1,-21.55,;38.33,-20.21,;36.78,-20.22,;36.02,-21.55,;38.32,-25.37,;39.08,-24.02,;38.96,-26.76,;37.83,-27.8,;37.84,-29.35,;36.5,-30.12,;35.17,-29.36,;33.83,-30.14,;32.5,-29.37,;31.16,-30.13,;31.13,-31.68,;32.36,-32.61,;29.66,-32.12,;28.78,-30.86,;29.71,-29.63,;29.26,-28.16,)|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a