Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Targetalpha-1 Nicotinic AChR
LigandBDBM50381980
Substrate/Competitorn/a
Meas. Tech.ChEMBL_815098
IC50 3981.07±n/a nM
Citation Skidmore, JAtcha, ZBoucherat, ECastelletti, LChen, DWCoppo, FTCutler, LDunsdon, RMHeath, BMHutchings, RHurst, DNJaved, SMartin, SMaskell, ESNorton, DPemberton, DJRedshaw, SRutter, RSehmi, SSScoccitti, TTemple, HETheobald, PWard, RWWilson, DM Identification of a series of 1,3,4-oxadiazol-2-amines as potent alpha-7 agonists with efficacy in the novel object recognition model of cognition. Bioorg Med Chem Lett22:3560-3 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
alpha-1 Nicotinic AChR
Name:Nicotinic acetylcholine receptor alpha-1/beta-1
Synonyms:Acetylcholine receptor protein alpha chain | Acetylcholine receptor subunit alpha | Cholinergic, Nicotinic Alpha1Beta1DeltaGamma | Cholinergic, Nicotinic Alpha1Beta2 | Nicotinic acetylcholine receptor alpha2/beta4 | n-AChR
Type:Ion channel
Mol. Mass.:54542.01
Organism:Homo sapiens (Human)
Description:n/a
Residue:482
Sequence:
MEPWPLLLLFSLCSAGLVLGSEHETRLVAKLFKDYSSVVRPVEDHRQVVEVTVGLQLIQL
INVDEVNQIVTTNVRLKQGDMVDLPRPSCVTLGVPLFSHLQNEQWVDYNLKWNPDDYGGV
KKIHIPSEKIWRPDLVLYNNADGDFAIVKFTKVLLQYTGHITWTPPAIFKSYCEIIVTHF
PFDEQNCSMKLGTWTYDGSVVAINPESDQPDLSNFMESGEWVIKESRGWKHSVTYSCCPD
TPYLDITYHFVMQRLPLYFIVNVIIPCLLFSFLTGLVFYLPTDSGEKMTLSISVLLSLTV
FLLVIVELIPSTSSAVPLIGKYMLFTMVFVIASIIITVIVINTHHRSPSTHVMPNWVRKV
FIDTIPNIMFFSTMKRPSREKQDKKIFTEDIDISDISGKPGPPPMGFHSPLIKHPEVKSA
IEGIKYIAETMKSDQESNNAAAEWKYVAMVMDHILLGVFMLVCIIGTLAVFAGRLIELNQ
QG
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50381980
NameBDBM50381980
Synonyms:CHEMBL2022495
TypeSmall organic molecule
Emp. Form.C24H28FN5O3
Mol. Mass.453.5092
SMILESCOc1cc(NC(=O)c2ccccc2F)ccc1-c1nnc(NCCCN2CCCCC2)o1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a