Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetGlycogen phosphorylase, muscle form
LigandBDBM50382962
Substrate/Competitorn/a
Meas. Tech.ChEMBL_818388
IC50 4000±n/a nM
Citation Krimm, ILancelin, JMPraly, JP Binding evaluation of fragment-based scaffolds for probing allosteric enzymes. J Med Chem55:1287-95 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Glycogen phosphorylase, muscle form
Name:Glycogen phosphorylase, muscle form
Synonyms:Glycogen Phosphorylase (PYGM) | Glycogen phosphorylase a (RMGPa) | Myophosphorylase
Type:Enzyme
Mol. Mass.:97296.32
Organism:Oryctolagus cuniculus (rabbit)
Description:Phosphorylation of Ser-15 converts phosphorylase B (unphosphorylated) to phosphorylase A.
Residue:843
Sequence:
MSRPLSDQEKRKQISVRGLAGVENVTELKKNFNRHLHFTLVKDRNVATPRDYYFALAHTV
RDHLVGRWIRTQQHYYEKDPKRIYYLSLEFYMGRTLQNTMVNLALENACDEATYQLGLDM
EELEEIEEDAGLGNGGLGRLAACFLDSMATLGLAAYGYGIRYEFGIFNQKICGGWQMEEA
DDWLRYGNPWEKARPEFTLPVHFYGRVEHTSQGAKWVDTQVVLAMPYDTPVPGYRNNVVN
TMRLWSAKAPNDFNLKDFNVGGYIQAVLDRNLAENISRVLYPNDNFFEGKELRLKQEYFV
VAATLQDIIRRFKSSKFGCRDPVRTNFDAFPDKVAIQLNDTHPSLAIPELMRVLVDLERL
DWDKAWEVTVKTCAYTNHTVLPEALERWPVHLLETLLPRHLQIIYEINQRFLNRVAAAFP
GDVDRLRRMSLVEEGAVKRINMAHLCIAGSHAVNGVARIHSEILKKTIFKDFYELEPHKF
QNKTNGITPRRWLVLCNPGLAEIIAERIGEEYISDLDQLRKLLSYVDDEAFIRDVAKVKQ
ENKLKFAAYLEREYKVHINPNSLFDVQVKRIHEYKRQLLNCLHVITLYNRIKKEPNKFVV
PRTVMIGGKAAPGYHMAKMIIKLITAIGDVVNHDPVVGDRLRVIFLENYRVSLAEKVIPA
ADLSEQISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEENFFIFGMRVEDVD
RLDQRGYNAQEYYDRIPELRQIIEQLSSGFFSPKQPDLFKDIVNMLMHHDRFKVFADYEE
YVKCQERVSALYKNPREWTRMVIRNIATSGKFSSDRTIAQYAREIWGVEPSRQRLPAPDE
KIP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50382962
NameBDBM50382962
Synonyms:CHEMBL2030479
TypeSmall organic molecule
Emp. Form.C16H19N3O7
Mol. Mass.365.338
SMILESOC[C@H]1O[C@@H](NC(=O)NC(=O)c2cc3ccccc3[nH]2)[C@H](O)[C@@H](O)[C@@H]1O |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a