Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target5-hydroxytryptamine receptor 2C
LigandBDBM50383092
Substrate/Competitorn/a
Meas. Tech.ChEMBL_818768
IC50 3.1±n/a nM
Citation Kamata, MYamashita, TImaeda, TTanaka, TMasada, SKamaura, MKasai, SHara, RSasaki, STakekawa, SAsami, AKaisho, TSuzuki, NAshina, SOgino, HNakano, YNagisa, YKato, KKato, KIshihara, Y Melanin-concentrating hormone receptor 1 antagonists. Synthesis and structure-activity relationships of novel 3-(aminomethyl)quinolines. J Med Chem55:2353-66 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
5-hydroxytryptamine receptor 2C
Name:Serotonin receptor (2b and 2c)
Synonyms:5-HT-2C | 5-HT2C | 5-HT2C-INI | 5-HT2c VGI | 5-HTR2C | 5-hydroxytryptamine receptor 1C | 5-hydroxytryptamine receptor 2A (5-HT2A) | 5-hydroxytryptamine receptor 2C (5-HT-2C) | 5-hydroxytryptamine receptor 2C (5HT-2C) | 5HT-1C | HTR1C | HTR2C | Serotonin (5-HT3) receptor | Serotonin 2c (5-HT2c) receptor | Serotonin Receptor 2C
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:51836.79
Organism:Homo sapiens (Human)
Description:P28335
Residue:458
Sequence:
MVNLRNAVHSFLVHLIGLLVWQCDISVSPVAAIVTDIFNTSDGGRFKFPDGVQNWPALSI
VIIIIMTIGGNILVIMAVSMEKKLHNATNYFLMSLAIADMLVGLLVMPLSLLAILYDYVW
PLPRYLCPVWISLDVLFSTASIMHLCAISLDRYVAIRNPIEHSRFNSRTKAIMKIAIVWA
ISIGVSVPIPVIGLRDEEKVFVNNTTCVLNDPNFVLIGSFVAFFIPLTIMVITYCLTIYV
LRRQALMLLHGHTEEPPGLSLDFLKCCKRNTAEEENSANPNQDQNARRRKKKERRPRGTM
QAINNERKASKVLGIVFFVFLIMWCPFFITNILSVLCEKSCNQKLMEKLLNVFVWIGYVC
SGINPLVYTLFNKIYRRAFSNYLRCNYKVEKKPPVRQIPRVAATALSGRELNVNIYRHTN
EPVIEKASDNEPGIEMQVENLELPVNPSSVVSERISSV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50383092
NameBDBM50383092
Synonyms:CHEMBL2031574
TypeSmall organic molecule
Emp. Form.C27H25FN2O2
Mol. Mass.428.498
SMILESFc1ccc(cc1)-c1ccc(cc1)C(=O)Nc1ccc2C=C(CN3CCCC3)COc2c1 |t:22|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a