Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetNuclear receptor subfamily 1 group D member 1
LigandBDBM50383677
Substrate/Competitorn/a
Meas. Tech.ChEMBL_819010
EC50 600±n/a nM
Citation Noel, RSong, XShin, YBanerjee, SKojetin, DLin, LRuiz, CHCameron, MDBurris, TPKamenecka, TM Synthesis and SAR of tetrahydroisoquinolines as Rev-erba agonists. Bioorg Med Chem Lett22:3739-42 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Nuclear receptor subfamily 1 group D member 1
Name:Nuclear receptor subfamily 1 group D member 1
Synonyms:EAR-1 | Rev-erbA-alpha | V-erbA-related protein 1
Type:PROTEIN
Mol. Mass.:66822.11
Organism:Homo sapiens
Description:ChEMBL_958222
Residue:614
Sequence:
MTTLDSNNNTGGVITYIGSSGSSPSRTSPESLYSDNSNGSFQSLTQGCPTYFPPSPTGSL
TQDPARSFGSIPPSLSDDGSPSSSSSSSSSSSSFYNGSPPGSLQVAMEDSSRVSPSKSTS
NITKLNGMVLLCKVCGDVASGFHYGVHACEGCKGFFRRSIQQNIQYKRCLKNENCSIVRI
NRNRCQQCRFKKCLSVGMSRDAVRFGRIPKREKQRMLAEMQSAMNLANNQLSSQCPLETS
PTQHPTPGPMGPSPPPAPVPSPLVGFSQFPQQLTPPRSPSPEPTVEDVISQVARAHREIF
TYAHDKLGSSPGNFNANHASGSPPATTPHRWENQGCPPAPNDNNTLAAQRHNEALNGLRQ
APSSYPPTWPPGPAHHSCHQSNSNGHRLCPTHVYAAPEGKAPANSPRQGNSKNVLLACPM
NMYPHGRSGRTVQEIWEDFSMSFTPAVREVVEFAKHIPGFRDLSQHDQVTLLKAGTFEVL
MVRFASLFNVKDQTVMFLSRTTYSLQELGAMGMGDLLSAMFDFSEKLNSLALTEEELGLF
TAVVLVSADRSGMENSASVEQLQETLLRALRALVLKNRPLETSRFTKLLLKLPDLRTLNN
MHSEKLLSFRVDAQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50383677
n/a
NameBDBM50383677
Synonyms:CHEMBL2030076
TypeSmall organic molecule
Emp. Form.C28H22F3NO3
Mol. Mass.477.4744
SMILESFC(F)(F)Oc1ccc(OCC2Cc3ccccc3CN2C(=O)c2cccc3ccccc23)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: