Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetOrexin receptor 1
LigandBDBM50384428
Substrate/Competitorn/a
Meas. Tech.ChEMBL_818372
IC50 2±n/a nM
Citation Jiang, RSong, XBali, PSmith, ABayona, CRLin, LCameron, MDMcDonald, PHKenny, PJKamenecka, TM Disubstituted piperidines as potent orexin (hypocretin) receptor antagonists. Bioorg Med Chem Lett22:3890-4 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Orexin receptor 1
Name:Orexin receptor 1
Synonyms:Hypocretin receptor type 1 | Orexin receptor type 1 | Orexin receptor type 1 (OR 1) | Orexin receptor type 1 (OR-1) | Orexin receptor type 1 (OX1) | Orexin receptor type 1 (OX1R) | Ox1r
Type:Protein
Mol. Mass.:47554.50
Organism:Homo sapiens (Human)
Description:O43613
Residue:425
Sequence:
MEPSATPGAQMGVPPGSREPSPVPPDYEDEFLRYLWRDYLYPKQYEWVLIAAYVAVFVVA
LVGNTLVCLAVWRNHHMRTVTNYFIVNLSLADVLVTAICLPASLLVDITESWLFGHALCK
VIPYLQAVSVSVAVLTLSFIALDRWYAICHPLLFKSTARRARGSILGIWAVSLAIMVPQA
AVMECSSVLPELANRTRLFSVCDERWADDLYPKIYHSCFFIVTYLAPLGLMAMAYFQIFR
KLWGRQIPGTTSALVRNWKRPSDQLGDLEQGLSGEPQPRARAFLAEVKQMRARRKTAKML
MVVLLVFALCYLPISVLNVLKRVFGMFRQASDREAVYACFTFSHWLVYANSAANPIIYNF
LSGKFREQFKAAFSCCLPGLGPCGSLKAPSPRSSASHKSLSLQSRCSISKISEHVVLTSV
TTVLP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50384428
NameBDBM50384428
Synonyms:CHEMBL2031491
TypeSmall organic molecule
Emp. Form.C28H28N4O2S
Mol. Mass.484.613
SMILESC[C@@H]1CCCN([C@@H]1CNC(=O)c1cccc2cccnc12)C(=O)c1nc(C)sc1-c1ccccc1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a