Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetTyrosine-protein kinase receptor TYRO3
LigandBDBM50384592
Substrate/Competitorn/a
Meas. Tech.ChEMBL_820661
IC50 1400±n/a nM
Citation Liu, JYang, CSimpson, CDeryckere, DVan Deusen, AMiley, MJKireev, DNorris-Drouin, JSather, SHunter, DKorboukh, VKPatel, HSJanzen, WPMachius, MJohnson, GLEarp, HSGraham, DKFrye, SVWang, X Discovery of Novel Small Molecule Mer Kinase Inhibitors for the Treatment of Pediatric Acute Lymphoblastic Leukemia. ACS Med Chem Lett3:129-134 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Tyrosine-protein kinase receptor TYRO3
Name:Tyrosine-protein kinase receptor TYRO3
Synonyms:TYRO3 | Tyrosine-protein kinase SKY | Tyrosine-protein kinase receptor TYRO3
Type:Protein
Mol. Mass.:96894.13
Organism:Homo sapiens (Human)
Description:Q06418
Residue:890
Sequence:
MALRRSMGRPGLPPLPLPPPPRLGLLLAALASLLLPESAAAGLKLMGAPVKLTVSQGQPV
KLNCSVEGMEEPDIQWVKDGAVVQNLDQLYIPVSEQHWIGFLSLKSVERSDAGRYWCQVE
DGGETEISQPVWLTVEGVPFFTVEPKDLAVPPNAPFQLSCEAVGPPEPVTIVWWRGTTKI
GGPAPSPSVLNVTGVTQSTMFSCEAHNLKGLASSRTATVHLQALPAAPFNITVTKLSSSN
ASVAWMPGADGRALLQSCTVQVTQAPGGWEVLAVVVPVPPFTCLLRDLVPATNYSLRVRC
ANALGPSPYADWVPFQTKGLAPASAPQNLHAIRTDSGLILEWEEVIPEAPLEGPLGPYKL
SWVQDNGTQDELTVEGTRANLTGWDPQKDLIVRVCVSNAVGCGPWSQPLVVSSHDRAGQQ
GPPHSRTSWVPVVLGVLTALVTAAALALILLRKRRKETRFGQAFDSVMARGEPAVHFRAA
RSFNRERPERIEATLDSLGISDELKEKLEDVLIPEQQFTLGRMLGKGEFGSVREAQLKQE
DGSFVKVAVKMLKADIIASSDIEEFLREAACMKEFDHPHVAKLVGVSLRSRAKGRLPIPM
VILPFMKHGDLHAFLLASRIGENPFNLPLQTLIRFMVDIACGMEYLSSRNFIHRDLAARN
CMLAEDMTVCVADFGLSRKIYSGDYYRQGCASKLPVKWLALESLADNLYTVQSDVWAFGV
TMWEIMTRGQTPYAGIENAEIYNYLIGGNRLKQPPECMEDVYDLMYQCWSADPKQRPSFT
CLRMELENILGQLSVLSASQDPLYINIERAEEPTAGGSLELPGRDQPYSGAGDGSGMGAV
GGTPSDCRYILTPGGLAEQPGQAEHQPESPLNETQRLLLLQQGLLPHSSC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50384592
NameBDBM50384592
Synonyms:CHEMBL2036628
TypeSmall organic molecule
Emp. Form.C19H24N6
Mol. Mass.336.4341
SMILESCNc1ncc2c(nn(C[C@H]3CC[C@H](N)CC3)c2n1)-c1ccccc1 |r,wU:10.9,wD:13.13,(2.58,-11.99,;3.91,-12.76,;5.24,-11.99,;5.25,-10.45,;6.57,-9.68,;7.91,-10.44,;9.38,-9.96,;10.3,-11.22,;9.38,-12.47,;9.86,-13.94,;8.83,-15.08,;9.31,-16.53,;8.27,-17.68,;6.76,-17.35,;5.73,-18.49,;6.29,-15.89,;7.32,-14.75,;7.91,-11.99,;6.58,-12.76,;9.86,-8.5,;11.37,-8.18,;11.84,-6.72,;10.81,-5.57,;9.3,-5.9,;8.83,-7.36,)|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a