Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetEstradiol 17-beta-dehydrogenase 1 (17beta-HSD1)
LigandBDBM50385891
Substrate/Competitorn/a
Meas. Tech.ChEMBL_823596
IC50 12±n/a nM
Citation Henn, CEinspanier, AMarchais-Oberwinkler, SFrotscher, MHartmann, RW Lead optimization of 17ß-HSD1 inhibitors of the (hydroxyphenyl)naphthol sulfonamide type for the treatment of endometriosis. J Med Chem55:3307-18 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Estradiol 17-beta-dehydrogenase 1 (17beta-HSD1)
Name:Estradiol 17-beta-dehydrogenase 1
Synonyms:17-beta-HSD 1 | 17-beta-hydroxysteroid dehydrogenase type 1 | 20 alpha-hydroxysteroid dehydrogenase | 20-alpha-HSD | E2DH | Estradiol 17-beta-dehydrogenase 1 | Placental 17-beta-hydroxysteroid dehydrogenase
Type:Enzyme
Mol. Mass.:34945.13
Organism:Homo sapiens (Human)
Description:P14061
Residue:328
Sequence:
MARTVVLITGCSSGIGLHLAVRLASDPSQSFKVYATLRDLKTQGRLWEAARALACPPGSL
ETLQLDVRDSKSVAAARERVTEGRVDVLVCNAGLGLLGPLEALGEDAVASVLDVNVVGTV
RMLQAFLPDMKRRGSGRVLVTGSVGGLMGLPFNDVYCASKFALEGLCESLAVLLLPFGVH
LSLIECGPVHTAFMEKVLGSPEEVLDRTDIHTFHRFYQYLAHSKQVFREAAQNPEEVAEV
FLTALRAPKPTLRYFTTERFLPLLRMRLDDPSGSNYVTAMHREVFGDVPAKAEAGAEAGG
GAGPGAEDEAGRGAVGDPELGDPPAAPQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50385891
NameBDBM50385891
Synonyms:CHEMBL2041378
TypeSmall organic molecule
Emp. Form.C30H24N2O5S
Mol. Mass.524.587
SMILESCC(=O)Nc1ccc(cc1)S(=O)(=O)Nc1cccc(c1)-c1c(O)ccc2cc(ccc12)-c1cccc(O)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a