Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetKynurenine--oxoglutarate transaminase 3
LigandBDBM50386292
Substrate/Competitorn/a
Meas. Tech.ChEMBL_826601
IC50 11000±n/a nM
Citation Dounay, ABAnderson, MBechle, BMCampbell, BMClaffey, MMEvdokimov, AEvrard, EFonseca, KRGan, XGhosh, SHayward, MMHorner, WKim, JYMcAllister, LAPandit, JParadis, VParikh, VDReese, MRRong, SSalafia, MASchuyten, KStrick, CATuttle, JBValentine, JWang, HZawadzke, LEVerhoest, PR Discovery of Brain-Penetrant, Irreversible Kynurenine Aminotransferase II Inhibitors for Schizophrenia. ACS Med Chem Lett3:187-192 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Kynurenine--oxoglutarate transaminase 3
Name:Kynurenine--oxoglutarate transaminase 3
Synonyms:CCBL2 | Cysteine-S-conjugate beta-lyase 2 | KAT3 | KATIII | Kynurenine aminotransferase III | Kynurenine--glyoxylate transaminase | Kynurenine--oxoglutarate transaminase III
Type:PROTEIN
Mol. Mass.:51406.81
Organism:Homo sapiens (Human)
Description:ChEMBL_939752
Residue:454
Sequence:
MFLAQRSLCSLSGRAKFLKTISSSKILGFSTSAKMSLKFTNAKRIEGLDSNVWIEFTKLA
ADPSVVNLGQGFPDISPPTYVKEELSKIAAIDSLNQYTRGFGHPSLVKALSYLYEKLYQK
QIDSNKEILVTVGAYGSLFNTIQALIDEGDEVILIVPFYDCYEPMVRMAGATPVFIPLRS
KPVYGKRWSSSDWTLDPQELESKFNSKTKAIILNTPHNPLGKVYNREELQVIADLCIKYD
TLCISDEVYEWLVYSGNKHLKIATFPGMWERTITIGSAGKTFSVTGWKLGWSIGPNHLIK
HLQTVQQNTIYTCATPLQEALAQAFWIDIKRMDDPECYFNSLPKELEVKRDRMVRLLESV
GLKPIVPDGGYFIIADVSLLDPDLSDMKNNEPYDYKFVKWMTKHKKLSAIPVSAFCNSET
KSQFEKFVRFCFIKKDSTLDAAEEIIKAWSVQKS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50386292
NameBDBM50386292
Synonyms:CHEMBL2047851
TypeSmall organic molecule
Emp. Form.C9H10N2O2
Mol. Mass.178.1879
SMILESN[C@H]1Cc2ccccc2N(O)C1=O |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a