BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCdc25C
LigandBDBM50388812
Substrate/Competitorn/a
Meas. Tech.ChEMBL_830917
IC50 44100±n/a nM
Citation  n/a ACS Med Chem Lett3:294-298 (2012)    Article
More Info.:Get all data from this article,  Assay Method
 
Cdc25C
Name:Cdc25C
Synonyms:Dual specificity phosphatase Cdc25C | M-phase inducer phosphatase 3
Type:Substrate
Mol. Mass.:53366.11
Organism:Homo sapiens (Human)
Description:P30307
Residue:473
Sequence:
MSTELFSSTREEGSSGSGPSFRSNQRKMLNLLLERDTSFTVCPDVPRTPVGKFLGDSANL
SILSGGTPKRCLDLSNLSSGEITATQLTTSADLDETGHLDSSGLQEVHLAGMNHDQHLMK
CSPAQLLCSTPNGLDRGHRKRDAMCSSSANKENDNGNLVDSEMKYLGSPITTVPKLDKNP
NLGEDQAEEISDELMEFSLKDQEAKVSRSGLYRSPSMPENLNRPRLKQVEKFKDNTIPDK
VKKKYFSGQGKLRKGLCLKKTVSLCDITITQMLEEDSNQGHLIGDFSKVCALPTVSGKHQ
DLKYVNPETVAALLSGKFQGLIEKFYVIDCRYPYEYLGGHIQGALNLYSQEELFNFFLKK
PIVPLDTQKRIIIVFHCEFSSERGPRMCRCLREEDRSLNQYPALYYPELYILKGGYRDFF
PEYMELCEPQSYCPMHHQDHKTELLRCRSQSKVQEGERQLREQIALLVKDMSP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50388812
n/a
NameBDBM50388812
Synonyms:CHEMBL2062707
TypeSmall organic molecule
Emp. Form.C28H43NO5
Mol. Mass.473.6447
SMILESCCCCCCCCCCCCCCCC(NCc1ccc(O)cc1)=C1C(=O)OC(CO)C1=O |w:15.15|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: