Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMelanocortin receptor 5 (MC5R)
LigandBDBM50389780
Substrate/Competitorn/a
Meas. Tech.ChEMBL_834299
Ki 2.9±n/a nM
Citation Conde-Frieboes, KThøgersen, HLau, JFSensfuss, UHansen, TKChristensen, LSpetzler, JOlsen, HBNilsson, CRaun, KDahl, KHansen, BSWulff, BS Identification and in vivo and in vitro characterization of long acting and melanocortin 4 receptor (MC4-R) selectivea-melanocyte-stimulating hormone (a-MSH) analogues. J Med Chem55:1969-77 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Melanocortin receptor 5 (MC5R)
Name:Melanocortin receptor (M4 and M5)
Synonyms:MC-2 | MC5-R | MC5R | Melanocortin MC5 | Melanocortin receptor 5
Type:Enzyme
Mol. Mass.:36612.92
Organism:Homo sapiens (Human)
Description:P33032
Residue:325
Sequence:
MNSSFHLHFLDLNLNATEGNLSGPNVKNKSSPCEDMGIAVEVFLTLGVISLLENILVIGA
IVKNKNLHSPMYFFVCSLAVADMLVSMSSAWETITIYLLNNKHLVIADAFVRHIDNVFDS
MICISVVASMCSLLAIAVDRYVTIFYALRYHHIMTARRSGAIIAGIWAFCTGCGIVFILY
SESTYVILCLISMFFAMLFLLVSLYIHMFLLARTHVKRIAALPGASSARQRTSMQGAVTV
TMLLGVFTVCWAPFFLHLTLMLSCPQNLYCSRFMSHFNMYLILIMCNSVMDPLIYAFRSQ
EMRKTFKEIICCRGFRIACSFPRRD
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50389780
NameBDBM50389780
Synonyms:CHEMBL2069317
TypeSmall organic molecule
Emp. Form.C92H143N27O20
Mol. Mass.1947.2887
SMILESCCCC[C@H](NC(=O)[C@H](CN(C)C)NC(=O)[C@H](Cc1cnc[nH]1)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CO)NC(=O)CNC(=O)COCCOCCNC(=O)CCCCCCCCCCCCCCCc1nnn[nH]1)C(=O)N[C@H]1CCC(=O)NCCCC[C@H](NC(=O)[C@H](Cc2c[nH]c3ccccc23)NC(=O)[C@H](CCCN=C(N)N)NC(=O)[C@@H](Cc2ccccc2)NC(=O)[C@@H]2C[C@@H](O)CN2C1=O)C(N)=O |r,wU:35.38,26.32,78.79,128.138,117.121,106.110,88.142,wD:16.23,8.12,4.4,92.94,130.135,(42.02,-50.97,;42.81,-49.65,;42.06,-48.29,;42.86,-46.97,;42.11,-45.63,;40.57,-45.63,;39.83,-44.24,;40.61,-42.94,;38.28,-44.24,;37.49,-45.55,;38.24,-46.9,;37.44,-48.22,;39.78,-46.9,;37.53,-42.88,;38.33,-41.56,;39.87,-41.56,;37.58,-40.22,;36.04,-40.22,;35.25,-41.51,;35.85,-42.93,;34.69,-43.95,;33.37,-43.16,;33.71,-41.66,;38.37,-38.9,;37.62,-37.55,;36.08,-37.55,;38.41,-36.23,;39.95,-36.23,;40.75,-34.96,;42.28,-34.96,;43.03,-36.31,;43.08,-33.64,;37.66,-34.88,;38.45,-33.56,;39.99,-33.56,;37.71,-32.22,;38.5,-30.9,;40.04,-30.9,;36.16,-32.22,;35.42,-30.85,;36.21,-29.53,;33.88,-30.85,;33.13,-29.47,;33.92,-28.15,;35.46,-28.15,;33.18,-26.81,;33.97,-25.49,;35.51,-25.49,;36.26,-26.86,;37.8,-26.86,;38.54,-28.24,;40.08,-28.24,;40.88,-26.97,;42.42,-26.97,;43.16,-28.32,;43.21,-25.65,;44.75,-25.65,;45.5,-27.03,;47.04,-27.03,;47.78,-28.4,;49.32,-28.4,;50.07,-29.77,;51.61,-29.77,;52.35,-31.15,;53.89,-31.15,;54.69,-29.86,;53.94,-28.51,;54.73,-27.19,;53.99,-25.84,;54.78,-24.52,;54.03,-23.17,;52.5,-22.99,;52.21,-21.48,;53.55,-20.73,;54.69,-21.79,;42.9,-44.31,;42.15,-42.96,;44.45,-44.31,;45.23,-43.02,;44.66,-41.59,;45.69,-39.96,;45.69,-31.65,;44.6,-30.56,;67.64,-31.65,;67.64,-36.79,;66.27,-37.55,;66.27,-39.08,;64.91,-39.84,;64.91,-41.38,;63.56,-42.12,;62.24,-41.33,;62.24,-39.8,;60.89,-42.09,;60.89,-43.63,;62.19,-44.41,;63.6,-43.81,;64.62,-44.97,;63.83,-46.29,;64.29,-47.76,;63.24,-48.89,;61.73,-48.55,;61.29,-47.08,;62.33,-45.95,;59.57,-41.3,;58.23,-42.05,;58.23,-43.59,;56.9,-41.26,;56.9,-39.72,;58.27,-38.97,;58.27,-37.43,;59.66,-36.68,;59.66,-35.14,;58.34,-34.35,;61,-34.39,;55.56,-42.01,;54.23,-41.23,;54.23,-39.68,;52.89,-41.97,;52.89,-43.51,;54.19,-44.3,;55.54,-43.55,;56.86,-44.34,;56.86,-45.88,;55.49,-46.63,;54.19,-45.84,;51.57,-41.18,;50.23,-41.93,;50.23,-43.47,;48.91,-41.14,;49.01,-39.59,;47.36,-39.23,;46.69,-37.7,;46.52,-40.68,;47.63,-41.95,;46.76,-43.23,;47.42,-44.61,;66.23,-42.17,;67.57,-41.42,;66.23,-43.7,)|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a