Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCasein kinase I isoform alpha
LigandBDBM50390497
Substrate/Competitorn/a
Meas. Tech.ChEMBL_835301
IC50 3540±n/a nM
Citation Hua, ZHuang, XBregman, HChakka, NDiMauro, EFDoherty, EMGoldstein, JGunaydin, HHuang, HMercede, SNewcomb, JPatel, VFTurci, SMYan, JWilson, CMartin, MW 2-Phenylamino-6-cyano-1H-benzimidazole-based isoform selective casein kinase 1 gamma (CK1¿) inhibitors. Bioorg Med Chem Lett22:5392-5 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Casein kinase I isoform alpha
Name:Casein kinase I isoform alpha
Synonyms:CK1 | CKI-alpha | CSNK1A1 | Casein Kinase I | Casein kinase 1 alpha (CK1 alpha)
Type:Serine/threonine-protein kinase
Mol. Mass.:38936.59
Organism:Homo sapiens (Human)
Description:P48729
Residue:337
Sequence:
MASSSGSKAEFIVGGKYKLVRKIGSGSFGDIYLAINITNGEEVAVKLESQKARHPQLLYE
SKLYKILQGGVGIPHIRWYGQEKDYNVLVMDLLGPSLEDLFNFCSRRFTMKTVLMLADQM
ISRIEYVHTKNFIHRDIKPDNFLMGIGRHCNKLFLIDFGLAKKYRDNRTRQHIPYREDKN
LTGTARYASINAHLGIEQSRRDDMESLGYVLMYFNRTSLPWQGLKAATKKQKYEKISEKK
MSTPVEVLCKGFPAEFAMYLNYCRGLRFEEAPDYMYLRQLFRILFRTLNHQYDYTFDWTM
LKQKAAQQAASSSGQGQQAQTPTGKQTDKTKSNMKGF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50390497
NameBDBM50390497
Synonyms:CHEMBL2071611
TypeSmall organic molecule
Emp. Form.C18H14N6
Mol. Mass.314.344
SMILESCn1cc(cn1)-c1ccc(Nc2nc3ccc(cc3[nH]2)C#N)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a